KEGG   Homo sapiens (human): 5176Help
Entry
5176              CDS       T01001                                 

Gene name
SERPINF1, EPC-1, OI12, OI6, PEDF, PIG35
Definition
(RefSeq) serpin family F member 1
  KO
K19614  pigment epithelium-derived factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H00506  Osteogenesis imperfecta
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    5176 (SERPINF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5176 (SERPINF1)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   5176 (SERPINF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 5176
NCBI-ProteinID: NP_001316832
OMIM: 172860
HGNC: 8824
Ensembl: ENSG00000132386
Vega: OTTHUMG00000090571
Pharos: P36955(Tbio)
UniProt: P36955 A0A140VKF3
LinkDB All DBs
Structure
PDB: 

Position
17p13.3
AA seq 418 aa AA seqDB search
MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN
FGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHG
TYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEI
NNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVR
VPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHD
IDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRA
GFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccctggtgctactcctctgcattggagccctcctcgggcacagcagctgccag
aaccctgccagccccccggaggagggctccccagaccccgacagcacaggggcgctggtg
gaggaggaggatcctttcttcaaagtccccgtgaacaagctggcagcggctgtctccaac
ttcggctatgacctgtaccgggtgcgatccagcacgagccccacgaccaacgtgctcctg
tctcctctcagtgtggccacggccctctcggccctctcgctgggagcggagcagcgaaca
gaatccatcattcaccgggctctctactatgacttgatcagcagcccagacatccatggt
acctataaggagctccttgacacggtcactgccccccagaagaacctcaagagtgcctcc
cggatcgtctttgagaagaagctgcgcataaaatccagctttgtggcacctctggaaaag
tcatatgggaccaggcccagagtcctgacgggcaaccctcgcttggacctgcaagagatc
aacaactgggtgcaggcgcagatgaaagggaagctcgccaggtccacaaaggaaattccc
gatgagatcagcattctccttctcggtgtggcgcacttcaaggggcagtgggtaacaaag
tttgactccagaaagacttccctcgaggatttctacttggatgaagagaggaccgtgagg
gtccccatgatgtcggaccctaaggctgttttacgctatggcttggattcagatctcagc
tgcaagattgcccagctgcccttgaccggaagcatgagtatcatcttcttcctgcccctg
aaagtgacccagaatttgaccttgatagaggagagcctcacctccgagttcattcatgac
atagaccgagaactgaagaccgtgcaggcggtcctcactgtccccaagctgaagctgagt
tatgaaggcgaagtcaccaagtccctgcaggagatgaagctgcaatccttgtttgattca
ccagactttagcaagatcacaggcaaacccatcaagctgactcaggtggaacaccgggct
ggctttgagtggaacgaggatggggcgggaaccacccccagcccagggctgcagcctgcc
cacctcaccttcccgctggactatcaccttaaccagcctttcatcttcgtactgagggac
acagacacaggggcccttctcttcattggcaagattctggaccccaggggcccctaa

DBGET integrated database retrieval system