KEGG   Homo sapiens (human): 51806Help
Entry
51806             CDS       T01001                                 

Gene name
CALML5, CLSP
Definition
(RefSeq) calmodulin like 5
  KO
K02183  calmodulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04744  Phototransduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa05010  Alzheimer disease
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05133  Pertussis
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05214  Glioma
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Lubeluzole: D04789
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    51806 (CALML5)
   04015 Rap1 signaling pathway
    51806 (CALML5)
   04371 Apelin signaling pathway
    51806 (CALML5)
   04020 Calcium signaling pathway
    51806 (CALML5)
   04070 Phosphatidylinositol signaling system
    51806 (CALML5)
   04024 cAMP signaling pathway
    51806 (CALML5)
   04022 cGMP-PKG signaling pathway
    51806 (CALML5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    51806 (CALML5)
   04218 Cellular senescence
    51806 (CALML5)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    51806 (CALML5)
  09152 Endocrine system
   04910 Insulin signaling pathway
    51806 (CALML5)
   04922 Glucagon signaling pathway
    51806 (CALML5)
   04912 GnRH signaling pathway
    51806 (CALML5)
   04915 Estrogen signaling pathway
    51806 (CALML5)
   04921 Oxytocin signaling pathway
    51806 (CALML5)
   04916 Melanogenesis
    51806 (CALML5)
   04924 Renin secretion
    51806 (CALML5)
   04925 Aldosterone synthesis and secretion
    51806 (CALML5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    51806 (CALML5)
   04270 Vascular smooth muscle contraction
    51806 (CALML5)
  09154 Digestive system
   04970 Salivary secretion
    51806 (CALML5)
   04971 Gastric acid secretion
    51806 (CALML5)
  09156 Nervous system
   04728 Dopaminergic synapse
    51806 (CALML5)
   04720 Long-term potentiation
    51806 (CALML5)
   04722 Neurotrophin signaling pathway
    51806 (CALML5)
  09157 Sensory system
   04744 Phototransduction
    51806 (CALML5)
   04740 Olfactory transduction
    51806 (CALML5)
   04750 Inflammatory mediator regulation of TRP channels
    51806 (CALML5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    51806 (CALML5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    51806 (CALML5)
  09162 Cancer: specific types
   05214 Glioma
    51806 (CALML5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    51806 (CALML5)
  09165 Substance dependence
   05031 Amphetamine addiction
    51806 (CALML5)
   05034 Alcoholism
    51806 (CALML5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    51806 (CALML5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    51806 (CALML5)
   05152 Tuberculosis
    51806 (CALML5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    51806 (CALML5)
   05163 Human cytomegalovirus infection
    51806 (CALML5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    51806 (CALML5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    51806 (CALML5)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51806 (CALML5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51806 (CALML5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    51806 (CALML5)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     51806 (CALML5)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    51806 (CALML5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     51806 (CALML5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   51806 (CALML5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_6 EF-hand_9 EF-hand_4 SPARC_Ca_bdg EF-hand_11 Dockerin_1 DUF5580 DUF2184 UPF0154
Motif
Other DBs
NCBI-GeneID: 51806
NCBI-ProteinID: NP_059118
OMIM: 605183
HGNC: 18180
Ensembl: ENSG00000178372
Vega: OTTHUMG00000017598
Pharos: Q9NZT1(Tbio)
UniProt: Q9NZT1 Q53H37
LinkDB All DBs
Structure
PDB: 

Position
10p15.1
AA seq 146 aa AA seqDB search
MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDG
DGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELD
AMIREADVDQDGRVNYEEFARMLAQE
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgagctgactcctgaggaggaggcccagtacaaaaaggctttctccgcggtt
gacacggatggaaacggcaccatcaatgcccaggagctgggcgcggcgctgaaggccacg
ggcaagaacctctcggaggcccagctaaggaaactcatctccgaggttgacagcgacggc
gacggcgaaatcagcttccaggagttcctgacggcggcgaagaaggccagggccggcctg
gaggacctgcaggtcgccttccgcgccttcgaccaggatggcgacggccacatcaccgtg
gacgagctcaggcgggccatggcggggctggggcagccgctgccgcaggaggagctggac
gccatgatccgcgaggccgacgtggaccaggacgggcgggtgaactacgaggagttcgcg
aggatgctcgcccaggagtga

DBGET integrated database retrieval system