KEGG   Homo sapiens (human): 5190
Entry
5190              CDS       T01001                                 

Gene name
PEX6, HMLR2, PAF-2, PAF2, PBD4A, PDB4B, PXAAA1
Definition
(RefSeq) peroxisomal biogenesis factor 6
  KO
K13339  peroxin-6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00205  Peroxisome biogenesis disorder
H01342  Zellweger syndrome
H01575  Roifman syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    5190 (PEX6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5190 (PEX6)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    5190 (PEX6)
SSDB
Motif
Pfam: AAA AAA_16 AAA_5 AAA_33 AAA_11 NACHT RuvB_N AAA_22 AAA_25 AAA_lid_3 TsaE RNA_helicase AAA_19 AAA_18 Mg_chelatase TIP49 AAA_17 AAA_7 Rad17 Vps4_C IstB_IS21 NTPase_1 AAA_2 PhoH DUF2075
Other DBs
NCBI-GeneID: 5190
NCBI-ProteinID: NP_000278
OMIM: 601498
HGNC: 8859
Ensembl: ENSG00000124587
Vega: OTTHUMG00000014713
Pharos: Q13608(Tbio)
UniProt: Q13608 A0A024RD09
LinkDB
Position
6p21.1
AA seq 980 aa
MALAVLRVLEPFPTETPPLAVLLPPGGPWPAAELGLVLALRPAGESPAGPALLVAALEGP
DAGTEEQGPGPPQLLVSRALLRLLALGSGAWVRARAVRRPPALGWALLGTSLGPGLGPRV
GPLLVRRGETLPVPGPRVLETRPALQGLLGPGTRLAVTELRGRARLCPESGDSSRPPPPP
VVSSFAVSGTVRRLQGVLGGTGDSLGVSRSCLRGLGLFQGEWVWVAQARESSNTSQPHLA
RVQVLEPRWDLSDRLGPGSGPLGEPLADGLALVPATLAFNLGCDPLEMGELRIQRYLEGS
IAPEDKGSCSLLPGPPFARELHIEIVSSPHYSTNGNYDGVLYRHFQIPRVVQEGDVLCVP
TIGQVEILEGSPEKLPRWREMFFKVKKTVGEAPDGPASAYLADTTHTSLYMVGSTLSPVP
WLPSEESTLWSSLSPPGLEALVSELCAVLKPRLQPGGALLTGTSSVLLRGPPGCGKTTVV
AAACSHLGLHLLKVPCSSLCAESSGAVETKLQAIFSRARRCRPAVLLLTAVDLLGRDRDG
LGEDARVMAVLRHLLLNEDPLNSCPPLMVVATTSRAQDLPADVQTAFPHELEVPALSEGQ
RLSILRALTAHLPLGQEVNLAQLARRCAGFVVGDLYALLTHSSRAACTRIKNSGLAGGLT
EEDEGELCAAGFPLLAEDFGQALEQLQTAHSQAVGAPKIPSVSWHDVGGLQEVKKEILET
IQLPLEHPELLSLGLRRSGLLLHGPPGTGKTLLAKAVATECSLTFLSVKGPELINMYVGQ
SEENVREVFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHSTQ
DVFVIGATNRPDLLDPALLRPGRFDKLVFVGANEDRASQLRVLSAITRKFKLEPSVSLVN
VLDCCPPQLTGADLYSLCSDAMTAALKRRVHDLEEGLEPGSSALMLTMEDLLQAAARLQP
SVSEQELLRYKRIQRKFAAC
NT seq 2943 nt   +upstreamnt  +downstreamnt
atggcgctggctgtcttgcgggtcctggagccctttccgaccgagacacccccgttggca
gtgctgctgccacccgggggcccgtggccggcggcggagctgggcctggtgctggccctg
aggcctgcaggggagagcccggcagggccggcgctgctggtggcagccctggaggggccg
gacgcgggcaccgaagagcagggtcccgggccgccgcagctactggttagccgcgcgctg
ctgcggctcctggcactgggctccggggcctgggtgcgggcgcgggcggtgcggcggccc
ccggcgctaggttgggcactgcttggcacctcgctggggcctgggctcggaccgcgagtc
gggccgctgctggtgaggcgcggagagaccctcccagtgcccggaccgcgggtgctggag
acgcggccggcgttgcaagggctgctgggcccagggactcggctggctgtgactgagctc
cgcgggcgggccagactgtgtccagagtctggggacagcagtcggcccccacccccgccc
gtggtgtcctcctttgcggtttctggcacagtgcggcgactccagggagttctgggaggg
actggagattcactaggggtgagccggagctgtctccgtggccttggcctcttccagggc
gaatgggtgtgggtggcccaggccagagagtcatcgaacacttcacagccgcacttggct
agggtgcaggtcctagaacctcgctgggacctctctgatagactgggacccggctctgga
ccgctgggagagcccctcgctgacggactggcgcttgtccctgccactttggcttttaat
cttggctgtgaccccctggaaatgggagagctcagaattcagaggtacttggaaggctcc
atcgcccctgaagacaaaggaagctgctcattgctgcctgggcctccatttgccagagag
ttacacatcgaaattgtgtcttctccccactacagcactaatggaaattatgacggtgtt
ctttaccggcactttcagatacccagggtagtccaggaaggggatgttctatgtgtgcca
acaattgggcaagtagagatcctggaaggaagtccagagaaactgcccaggtggcgggaa
atgttttttaaagtgaagaaaacagttggggaagctccagatggaccagccagtgcctac
ttggccgacaccacccatacctccttgtacatggtgggttctaccctgagccctgttcca
tggctcccttcagaggaatccactctctggagcagtttgtctcctccaggcctggaggcc
ttggtgtctgaactctgtgctgtcctgaagcctcgcctccagccagggggtgccctgctg
acaggaactagcagtgtccttctacggggccccccaggctgtgggaagaccacagtagtt
gctgctgcctgtagtcaccttgggctccacttactgaaggtgccctgctccagcctctgt
gcagaaagtagtggggctgtggagacaaaactgcaggccatcttctcccgggcccgccgt
tgccggcctgcagtcctgttgctcacagctgtggaccttctgggccgggaccgtgatggg
ctgggtgaggatgcccgtgtgatggctgtgctgcgtcacctcctcctcaatgaggacccc
ctcaacagctgccctcccctcatggttgtggccaccacaagccgggcccaggacctgcct
gctgatgtgcagacagcatttcctcatgagctcgaggtgcctgctctgtcagaggggcag
cggctcagcatcctgcgggccctcactgcccaccttcccctgggccaggaggtgaacttg
gcacagctagcacggcggtgtgcaggctttgtggtaggggatctctatgcccttctgacc
cacagcagccgggcagcctgcaccaggatcaagaactcaggtttggcaggtggcttgact
gaggaggatgagggggagctgtgtgctgccggctttcctctcctggctgaggactttggg
caggcactggagcaactgcagacagctcactcccaggccgttggagcccccaagatcccc
tcagtgtcctggcatgatgtgggtgggctgcaggaggtgaagaaggagatcctggagacc
attcagctccccctggagcaccctgagctactgagcctgggcctgagacgctcaggcctt
ctgctccatgggccccctggcaccggcaagacccttctggccaaggcagtagccactgag
tgcagccttaccttcctcagcgtgaaggggccagagctcattaacatgtatgtgggccaa
agtgaggagaatgtgcgggaagtgtttgccagggccagggctgcagctccatgcattatc
ttctttgatgaactggactctttggccccaagccgggggcgaagtggagattctggagga
gtgatggacagggtggtgtctcagctccttgccgagctagatgggctgcacagcactcag
gatgtgtttgtgattggagccaccaacagaccagatctcctggaccctgcccttctgcgg
cctggcagatttgacaagctggtgtttgtgggggcaaatgaggaccgggcctcccagcta
cgcgttctaagtgccatcacacgcaaattcaagctagagccatctgtgagcctggtaaac
gtgctagattgctgccctccccagctgacgggcgcggacctctactctctctgctctgat
gctatgacagctgccctcaaacgcagggttcatgacctggaggaagggctggagccaggt
agctcagcactgatgctcaccatggaggacttgctgcaggctgccgcccggctgcaaccc
tcagtcagtgagcaggagctgctccggtacaagcgcatccagcgcaagtttgctgcctgc
tag

DBGET integrated database retrieval system