KEGG   Homo sapiens (human): 5194
Entry
5194              CDS       T01001                                 

Gene name
PEX13, NALD, PBD11A, PBD11B, ZWS
Definition
(RefSeq) peroxisomal biogenesis factor 13
  KO
K13344  peroxin-13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00177  Neonatal adrenoleukodystrophy
H00205  Peroxisome biogenesis disorder
H01342  Zellweger syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    5194 (PEX13)
SSDB
Motif
Pfam: Peroxin-13_N SH3_9 SH3_1 SH3_2
Other DBs
NCBI-GeneID: 5194
NCBI-ProteinID: NP_002609
OMIM: 601789
HGNC: 8855
Ensembl: ENSG00000162928
Vega: OTTHUMG00000129422
Pharos: Q92968(Tbio)
UniProt: Q92968
LinkDB
Position
2p15
AA seq 403 aa
MASQPPPPPKPWETRRIPGAGPGPGPGPTFQSADLGPTLMTRPGQPALTRVPPPILPRPS
QQTGSSSVNTFRPAYSSFSSGYGAYGNSFYGGYSPYSYGYNGLGYNRLRVDDLPPSRFVQ
QAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHFTKVFS
AFALVRTIRYLYRRLQRMLGLRRGSENEDLWAESEGTVACLGAEDRAATSAKSWPIFLFF
AVILGGPYLIWKLLSTHSDEVTDSINWASGEDDHVVARAEYDFAAVSEEEISFRAGDMLN
LALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRKGRKTVESSKVSKQQQSFTNPTL
TKGATVADSLDEQEAAFESVFVETNKVPVAPDSIGKDGEKQDL
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcgtcccagccgccacctccccccaaaccctgggagacccgccgaattccgggagcc
ggaccgggaccaggaccgggccccactttccaatctgctgatttgggtcctactttaatg
acaagacctggacaaccagcacttaccagagtgcccccacctattcttccaaggccatca
cagcagacaggaagtagcagtgtgaacacttttagacctgcttacagttcattttcttct
ggatatggtgcctatggaaattcattttatggaggctatagtccttatagttatggatat
aatgggctgggctacaaccgcctccgtgtagatgatcttccacccagtagatttgttcag
caagctgaagaaagcagcaggggtgcatttcagtccattgaaagtattgtgcatgcattt
gcctctgtcagtatgatgatggatgctaccttttcagctgtctataacagtttcagggct
gtattggatgtagcaaatcacttttcccgattgaaaatacactttacaaaagtgttttca
gcttttgcattggttaggactatacggtatctttacagacggctacagcggatgttaggt
ttaagaagaggctctgagaatgaagacctctgggcagagagtgaaggaactgtggcatgc
cttggtgctgaggaccgagcagctacctcagcaaaatcttggccaatattcttgttcttt
gctgttatccttggtggtccttacctcatttggaaactattgtctactcacagtgatgaa
gtaacagacagcatcaactgggcaagtggtgaggatgaccatgtagttgccagagcagaa
tatgattttgctgccgtatctgaagaagaaatttctttccgggctggtgatatgctgaac
ttagctctcaaagaacaacaacccaaagtgcgtggttggcttctggctagccttgatggc
caaacaacaggacttatacctgcgaattatgtcaaaattcttggcaaaagaaaaggtagg
aaaacggtggaatcaagtaaagtttccaagcagcaacaatcttttaccaacccaacacta
actaaaggagccacggttgctgattctttggatgaacaggaagctgcctttgaatctgtt
tttgttgaaactaataaggttccagttgcacctgattccattgggaaagatggagaaaag
caagatctttga

DBGET integrated database retrieval system