KEGG   Homo sapiens (human): 5199Help
Entry
5199              CDS       T01001                                 

Gene name
CFP, BFD, PFC, PFD, PROPERDIN
Definition
(RefSeq) complement factor properdin
  KO
K15412  complement factor properdin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Network
nt06136  Complement activation (virus)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00589  HSV gC to alternative pathway of complement activation
Disease
H00104  Alternative complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    5199 (CFP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_1 TSR
Motif
Other DBs
NCBI-GeneID: 5199
NCBI-ProteinID: NP_001138724
OMIM: 300383
HGNC: 8864
Ensembl: ENSG00000126759
Vega: OTTHUMG00000021451
Pharos: P27918(Tbio)
UniProt: P27918 A0A0S2Z4I5
LinkDB All DBs
Structure
PDB: 

Position
Xp11.23
AA seq 469 aa AA seqDB search
MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNT
AFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTL
EWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQE
SEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPG
LAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDA
TRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRC
AGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSM
VEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagagggagcgcaggcccctcgattgttgctgccgccgctgctcctgctgctc
accctgccagccacaggctcagaccccgtgctctgcttcacccagtatgaagaatcctcc
ggcaagtgcaagggcctcctggggggtggtgtcagcgtggaagactgctgtctcaacact
gcctttgcctaccagaaacgtagtggtgggctctgtcagccttgcaggtccccacgatgg
tccctgtggtccacatgggccccctgttcggtgacgtgctctgagggctcccagctgcgg
taccggcgctgtgtgggctggaatgggcagtgctctggaaaggtggcacctgggaccctg
gagtggcagctccaggcctgtgaggaccagcagtgctgtcctgagatgggcggctggtct
ggctgggggccctgggagccttgctctgtcacctgctccaaagggacccggacccgcagg
cgagcctgtaatcaccctgctcccaagtgtgggggccactgcccaggacaggcacaggaa
tcagaggcctgtgacacccagcaggtctgccccacacacggggcctgggccacctggggc
ccctggaccccctgctcagcctcctgccacggtggaccccacgaacctaaggagacacga
agccgcaagtgttctgcacctgagccctcccagaaacctcctgggaagccctgcccgggg
ctagcctacgagcagcggaggtgcaccggcctgccaccctgcccagtggctgggggctgg
gggccttggggccctgtgagcccctgccctgtgacctgtggcctgggccagaccatggaa
caacggacgtgcaatcaccctgtgccccagcatgggggccccttctgtgctggcgatgcc
acccggacccacatctgcaacacagctgtgccctgccctgtggatggggagtgggactcg
tggggggagtggagcccctgtatccgacggaacatgaagtccatcagctgtcaagaaatc
ccgggccagcagtcacgcgggaggacctgcaggggccgcaagtttgacggacatcgatgt
gccgggcaacagcaggatatccggcactgctacagcatccagcactgccccttgaaagga
tcatggtcagagtggagtacctgggggctgtgcatgcccccctgtggacctaatcctacc
cgtgcccgccagcgcctctgcacacccttgctccccaagtacccgcccaccgtttccatg
gtcgaaggtcagggcgagaagaacgtgaccttctgggggagaccgctgccacggtgtgag
gagctacaagggcagaagctggtggtggaggagaaacgaccatgtctacacgtgcctgct
tgcaaagaccctgaggaagaggaactctaa

DBGET integrated database retrieval system