KEGG   Homo sapiens (human): 5207
Entry
5207              CDS       T01001                                 

Gene name
PFKFB1, F6PK, HL2K, PFRX
Definition
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1
  KO
K19028  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 1 [EC:2.7.1.105 3.1.3.46]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa04152  AMPK signaling pathway
hsa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    5207 (PFKFB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    5207 (PFKFB1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5207 (PFKFB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     5207 (PFKFB1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     5207 (PFKFB1)
SSDB
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 Zeta_toxin KTI12
Other DBs
NCBI-GeneID: 5207
NCBI-ProteinID: NP_002616
OMIM: 311790
HGNC: 8872
Ensembl: ENSG00000158571
Vega: OTTHUMG00000021643
Pharos: P16118(Tbio)
UniProt: P16118
LinkDB
Structure
PDB: 
1K6M

Position
Xp11.21
AA seq 471 aa
MSPEMGELTQTRLQKIWIPHSSGSSRLQRRRGSSIPQFTNSPTMVIMVGLPARGKTYIST
KLTRYLNWIGTPTKVFNLGQYRREAVSYKNYEFFLPDNMEALQIRKQCALAALKDVHNYL
SHEEGHVAVFDATNTTRERRSLILQFAKEHGYKVFFIESICNDPGIIAENIRQVKLGSPD
YIDCDREKVLEDFLKRIECYEVNYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHIQSRT
VYYLMNIHVTPRSIYLCRHGESELNIRGRIGGDSGLSVRGKQYAYALANFIQSQGISSLK
VWTSHMKRTIQTAEALGVPYEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRY
RYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLH
TVLKLTPVAYGCKVESIYLNVEAVNTHREKPENVDITREPEEALDTVPAHY
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgtctccagagatgggagagctcacccaaaccaggttgcagaagatctggattccacac
agcagcggcagcagcaggctgcaacggagaaggggctcatccataccccagtttaccaat
tcccccacaatggtgatcatggtgggtttaccagctcgaggcaagacctatatctccaca
aagctcacacgatatctcaactggataggaacaccaactaaagtgtttaatttaggccag
tatcgacgagaggcagtgagctacaagaactatgaattctttcttccagacaacatggaa
gccctgcaaatcaggaagcagtgcgccctggcagccctgaaggatgttcacaactatctc
agccatgaggaaggtcatgttgcggtttttgatgccaccaacactaccagagaacgacgg
tcactgatcctgcagtttgcaaaagaacatggttacaaggtgtttttcattgagtccatt
tgtaatgaccctggcataattgcagaaaacatcaggcaagtgaaacttggcagccctgat
tatatagactgtgaccgggaaaaggttctggaagactttctaaagagaattgagtgctat
gaggtcaactaccaacccttggatgaggaactggacagccacctgtcctacatcaagatc
ttcgacgtgggcacacgctacatggtgaaccgagtgcaggatcacatccagagccgcaca
gtctactacctcatgaatatccatgtcacacctcgctccatctacctttgccgacatggc
gagagtgaactcaacatcagaggccgcatcggaggtgactctggcctctcagttcgcggc
aagcagtatgcctatgccctggccaacttcattcagtcccagggcatcagctccctgaag
gtgtggaccagtcacatgaagaggaccatccagacagctgaggccctgggtgtcccctat
gagcagtggaaggccctgaatgagattgatgcgggtgtctgtgaggagatgacctatgaa
gaaatccaggaacattaccctgaagaatttgcactgcgagaccaagataaatatcgctac
cgctatcccaagggagagtcctatgaggatctggttcagcgtctggagccagtgataatg
gagctagaacgacaggagaatgtactggtgatctgccaccaggctgtcatgcggtgcctc
ctggcctatttcctggataaaagttcagatgagcttccatatctcaagtgccctctgcac
acagtgctcaaactcactcctgtggcttatggctgcaaagtggaatccatctacctgaat
gtggaggccgtgaacacacaccgggagaagcctgagaatgtggacatcacccgggaacct
gaggaagccctggatactgtcccagcccactactga

KEGG   Homo sapiens (human): 5208
Entry
5208              CDS       T01001                                 

Gene name
PFKFB2, PFK-2/FBPase-2
Definition
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
  KO
K19029  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 2 [EC:2.7.1.105 3.1.3.46]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa04152  AMPK signaling pathway
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    5208 (PFKFB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    5208 (PFKFB2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    5208 (PFKFB2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     5208 (PFKFB2)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     5208 (PFKFB2)
SSDB
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 KTI12 His_Phos_2 Zeta_toxin
Other DBs
NCBI-GeneID: 5208
NCBI-ProteinID: NP_006203
OMIM: 171835
HGNC: 8873
Ensembl: ENSG00000123836
Vega: OTTHUMG00000036033
Pharos: O60825(Tchem)
UniProt: O60825
LinkDB
Structure
PDB: 
5HTK

Position
1q32.1
AA seq 505 aa
MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTR
YLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEE
NGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPE
RNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVY
YLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVW
TSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRY
PGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTI
FKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPR
NYSVGSRPLKPLSPLRAQDMQEGAD
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgtctggggcatcttcctcagaacagaacaacaacagctatgaaaccaaaaccccaaat
cttcgaatgtcagagaagaaatgttcatgggcctcctacatgaccaactccccgactctg
atcgttatgattggtttgccagcccggggtaaaacctacgtgtccaagaaactaacacgc
tacctcaactggattggagtccccaccaaagtgtttaatcttggggtgtatcggcgtgaa
gcagtcaagtcctataagtcctacgacttctttcggcatgacaatgaggaggccatgaag
atccgcaaacagtgtgctctggtggcgctggaagatgttaaggcgtatctcactgaggag
aatggtcagattgcggtgtttgatgccaccaatacaacccgggagaggagggacatgatt
ttgaactttgctgaacagaattccttcaaggtattctttgtggaatccgtctgtgatgat
cctgatgtcattgctgccaatattctggaggttaaggtatcaagccctgactatcctgaa
aggaacagagagaacgtgatggaggacttcctgaagagaattgaatgctacaaagttacc
taccgacctcttgacccagacaactatgacaaggatctttctttcatcaaggtgataaac
gtgggccagcgatttttagtcaacagagtccaggactacatccagagcaagatagtctac
tacctcatgaatatccacgtccagcctcgcaccatttacctttgccggcatggagaaagc
gagttcaatctcttggggaagattgggggtgactctggcctctcggtgcggggaaagcag
tttgcccaagctctaaggaaatttctggaggaacaggaaataacagacctcaaagtgtgg
acaagccagttgaagaggaccatacagactgctgaatctctcggggtgccctatgagcag
tggaagattctgaatgagattgatgctggtgtgtgtgaagagatgacctatgcagagatt
gagaaacggtacccagaagagtttgcacttcgagatcaagagaagtatctgtatcgatat
cctggtggggagtcataccaggacctggtgcagcggctggagcctgtcatcatggagctg
gaacgtcagggcaatgtcctcgtcatctcccaccaggctgtcatgcgctgcctcctggcc
tacttcttggataagggcgcagatgagctaccatacttgagatgccctctccataccatc
ttcaaacttactcctgtggcctatgggtgcaaagtggaaacaattaaacttaacgtggag
gctgtgaacacgcaccgtgacaagccaactaacaacttccccaagaaccaaacccctgta
aggatgagaaggaacagctttacgcctctgtccagttcgaatacaataaggcgtccaaga
aattacagtgttgggagccggcccctcaagcccctcagccctctccgtgcccaggacatg
caagaaggggccgactag

KEGG   Homo sapiens (human): 5209
Entry
5209              CDS       T01001                                 

Gene name
PFKFB3, IPFK2, PFK2, iPFK-2
Definition
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
  KO
K01103  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 3 [EC:2.7.1.105 3.1.3.46]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa04066  HIF-1 signaling pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    5209 (PFKFB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    5209 (PFKFB3)
   04152 AMPK signaling pathway
    5209 (PFKFB3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     5209 (PFKFB3)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     5209 (PFKFB3)
SSDB
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 KTI12 AAA_17 Zeta_toxin SRP54 DIL AAA_18
Other DBs
NCBI-GeneID: 5209
NCBI-ProteinID: NP_004557
OMIM: 605319
HGNC: 8874
Ensembl: ENSG00000170525
Vega: OTTHUMG00000017621
Pharos: Q16875(Tchem)
UniProt: Q16875
LinkDB
Structure
PDB: 

Position
10p15.1
AA seq 520 aa
MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLN
WIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQ
IAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNS
AEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQ
LKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTG
ESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKL
TPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFE
EHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgccgttggaactgacgcagagccgagtgcagaagatctgggtgcccgtggaccacagg
ccctcgttgcccagatcctgtgggccaaagctgaccaactcccccaccgtcatcgtcatg
gtgggcctccccgcccggggcaagacctacatctccaagaagctgactcgctacctcaac
tggattggcgtccccacaaaagtgttcaacgtcggggagtatcgccgggaggctgtgaag
cagtacagctcctacaacttcttccgccccgacaatgaggaagccatgaaagtccggaag
caatgtgccttagctgccttgagagatgtcaaaagctacctggcgaaagaagggggacaa
attgcggttttcgatgccaccaatactactagagagaggagacacatgatccttcatttt
gccaaagaaaatgactttaaggcgtttttcatcgagtcggtgtgcgacgaccctacagtt
gtggcctccaatatcatggaagttaaaatctccagcccggattacaaagactgcaactcg
gcagaagccatggacgacttcatgaagaggatcagttgctatgaagccagctaccagccc
ctcgaccccgacaaatgcgacagggacttgtcgctgatcaaggtgattgacgtgggccgg
aggttcctggtgaaccgggtgcaggaccacatccagagccgcatcgtgtactacctgatg
aacatccacgtgcagccgcgtaccatctacctgtgccggcacggcgagaacgagcacaac
ctccagggccgcatcgggggcgactcaggcctgtccagccggggcaagaagtttgccagt
gctctgagcaagttcgtggaggagcagaacctgaaggacctgcgcgtgtggaccagccag
ctgaagagcaccatccagacggccgaggcgctgcggctgccctacgagcagtggaaggcg
ctcaatgagatcgacgcgggcgtctgtgaggagctgacctacgaggagatcagggacacc
taccctgaggagtatgcgctgcgggagcaggacaagtactattaccgctaccccaccggg
gagtcctaccaggacctggtccagcgcttggagccagtgatcatggagctggagcggcag
gagaatgtgctggtcatctgccaccaggccgtcctgcgctgcctgcttgcctacttcctg
gataagagtgcagaggagatgccctacctgaaatgccctcttcacaccgtcctgaaactg
acgcctgtcgcttatggctgccgtgtggaatccatctacctgaacgtggagtccgtctgc
acacaccgggagaggtcagaggatgcaaagaagggacctaacccgctcatgagacgcaat
agtgtcaccccgctagccagccccgaacccaccaaaaagcctcgcatcaacagctttgag
gagcatgtggcctccacctcggccgccctgcccagctgcctgcccccggaggtgcccacg
cagctgcctggacaaaacatgaaaggctcccggagcagcgctgactcctccaggaaacac
tga

KEGG   Homo sapiens (human): 5210
Entry
5210              CDS       T01001                                 

Gene name
PFKFB4
Definition
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
  KO
K19030  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 4 [EC:2.7.1.105 3.1.3.46]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    5210 (PFKFB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    5210 (PFKFB4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     5210 (PFKFB4)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     5210 (PFKFB4)
SSDB
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 Prefoldin KTI12 His_Phos_2 AAA_18 Zeta_toxin
Other DBs
NCBI-GeneID: 5210
NCBI-ProteinID: NP_004558
OMIM: 605320
HGNC: 8875
Ensembl: ENSG00000114268
Vega: OTTHUMG00000133528
Pharos: Q16877(Tbio)
UniProt: Q16877
LinkDB
Position
3p21.31
AA seq 469 aa
MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLT
RYLNWIGVPTREFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSE
EGGHVAVFDATNTTRERRATIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYV
NRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVY
YLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFAKSLAQFISDQNIKDLKVW
TSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFALRDQDKYRYRY
PKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTV
LKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAHQ
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggcgtccccacgggaattgacacagaaccccctgaagaagatctggatgccatacagc
aatgggcggcccgctctgcacgcttgccagcgcggtgtgtgcatgaccaactgcccaact
ctcattgtcatggtgggcctgcccgccaggggcaagacctacatctccaagaagctgact
cgatacctgaactggattggtgtgcccactcgggagttcaatgttggccagtatcgccgg
gacgtggtcaagacctacaaatcttttgaattttttctccccgacaatgaagagggcctg
aaaatcaggaagcagtgtgccctggcagccctccgtgacgtccggcggttccttagtgag
gaggggggacatgtggcggtttttgatgccacaaacaccacccgagaacggagagcgacc
atctttaattttggagaacagaatggctacaagaccttttttgtcgagtccatctgtgtg
gatcctgaggtcatagctgccaacatcgtgcaagtgaaactgggcagccctgactatgtc
aaccgcgacagtgatgaggctacggaggacttcatgaggcgcattgagtgctatgagaac
tcctacgagtcgctagatgaggacctggatagggacctgtcctatatcaagatcatggat
gtgggccagagctacgtggtgaaccgtgtggctgaccacatccagagccgcatcgtatat
tacctcatgaacatccacgtgaccccccgctccatctacctctgccggcacggggagagc
gagctcaacctcaagggccggattggcggggacccaggactgtcccctcggggcagggag
tttgccaagagtctagcccagttcatcagtgaccaaaatatcaaggatctgaaggtctgg
acaagccagatgaagaggacaatccagacggctgaggcactgggtgtgccctatgaacag
tggaaggtcctcaacgagatcgatgcgggcgtctgtgaggaaatgacctacgaggaaatt
caggataattatccactggagttcgccctgcgggaccaggacaagtaccggtaccggtac
cctaaaggggagtcctacgaggacctggtccagagactggagcctgtcatcatggagctg
gagaggcaagagaatgtgctggtcatctgccaccaggctgtgatgcgctgcctgctggcc
tacttcctcgacaaggcagcagaacagctgccctacctcaagtgtccgctgcacacagtc
ctgaagctgactcctgtggcatatggttgtaaagtggagtccatattcctgaacgtggct
gctgtgaacacgcaccgggacaggcctcagaacgtggacatctcaagacctccagaggaa
gcccttgtcacggtgcctgctcaccagtga

DBGET integrated database retrieval system