KEGG   Homo sapiens (human): 5209Help
Entry
5209              CDS       T01001                                 

Gene name
PFKFB3, IPFK2, PFK2, iPFK-2
Definition
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
  KO
K01103  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 3 [EC:2.7.1.105 3.1.3.46]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa04066  HIF-1 signaling pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    5209 (PFKFB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    5209 (PFKFB3)
   04152 AMPK signaling pathway
    5209 (PFKFB3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     5209 (PFKFB3)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     5209 (PFKFB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PF2K His_Phos_1 AAA_33 KTI12 AAA_17 SRP54 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 5209
NCBI-ProteinID: NP_004557
OMIM: 605319
HGNC: 8874
Ensembl: ENSG00000170525
Vega: OTTHUMG00000017621
Pharos: Q16875(Tchem)
UniProt: Q16875
LinkDB All DBs
Structure
PDB: 

Position
10p15.1
AA seq 520 aa AA seqDB search
MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLN
WIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQ
IAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNS
AEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQ
LKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTG
ESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKL
TPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFE
EHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccgttggaactgacgcagagccgagtgcagaagatctgggtgcccgtggaccacagg
ccctcgttgcccagatcctgtgggccaaagctgaccaactcccccaccgtcatcgtcatg
gtgggcctccccgcccggggcaagacctacatctccaagaagctgactcgctacctcaac
tggattggcgtccccacaaaagtgttcaacgtcggggagtatcgccgggaggctgtgaag
cagtacagctcctacaacttcttccgccccgacaatgaggaagccatgaaagtccggaag
caatgtgccttagctgccttgagagatgtcaaaagctacctggcgaaagaagggggacaa
attgcggttttcgatgccaccaatactactagagagaggagacacatgatccttcatttt
gccaaagaaaatgactttaaggcgtttttcatcgagtcggtgtgcgacgaccctacagtt
gtggcctccaatatcatggaagttaaaatctccagcccggattacaaagactgcaactcg
gcagaagccatggacgacttcatgaagaggatcagttgctatgaagccagctaccagccc
ctcgaccccgacaaatgcgacagggacttgtcgctgatcaaggtgattgacgtgggccgg
aggttcctggtgaaccgggtgcaggaccacatccagagccgcatcgtgtactacctgatg
aacatccacgtgcagccgcgtaccatctacctgtgccggcacggcgagaacgagcacaac
ctccagggccgcatcgggggcgactcaggcctgtccagccggggcaagaagtttgccagt
gctctgagcaagttcgtggaggagcagaacctgaaggacctgcgcgtgtggaccagccag
ctgaagagcaccatccagacggccgaggcgctgcggctgccctacgagcagtggaaggcg
ctcaatgagatcgacgcgggcgtctgtgaggagctgacctacgaggagatcagggacacc
taccctgaggagtatgcgctgcgggagcaggacaagtactattaccgctaccccaccggg
gagtcctaccaggacctggtccagcgcttggagccagtgatcatggagctggagcggcag
gagaatgtgctggtcatctgccaccaggccgtcctgcgctgcctgcttgcctacttcctg
gataagagtgcagaggagatgccctacctgaaatgccctcttcacaccgtcctgaaactg
acgcctgtcgcttatggctgccgtgtggaatccatctacctgaacgtggagtccgtctgc
acacaccgggagaggtcagaggatgcaaagaagggacctaacccgctcatgagacgcaat
agtgtcaccccgctagccagccccgaacccaccaaaaagcctcgcatcaacagctttgag
gagcatgtggcctccacctcggccgccctgcccagctgcctgcccccggaggtgcccacg
cagctgcctggacaaaacatgaaaggctcccggagcagcgctgactcctccaggaaacac
tga

DBGET integrated database retrieval system