KEGG   Homo sapiens (human): 5214Help
Entry
5214              CDS       T01001                                 

Gene name
PFKP, ATP-PFK, PFK-C, PFK-P, PFKF
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00030  Pentose phosphate pathway
hsa00051  Fructose and mannose metabolism
hsa00052  Galactose metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa03018  RNA degradation
hsa04152  AMPK signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5214 (PFKP)
   00030 Pentose phosphate pathway
    5214 (PFKP)
   00051 Fructose and mannose metabolism
    5214 (PFKP)
   00052 Galactose metabolism
    5214 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    5214 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    5214 (PFKP)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    5214 (PFKP)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    5214 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    5214 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hsa03019]
    5214 (PFKP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     5214 (PFKP)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5214 (PFKP)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     5214 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 5214
NCBI-ProteinID: NP_002618
OMIM: 171840
HGNC: 8878
Ensembl: ENSG00000067057
Vega: OTTHUMG00000017556
Pharos: Q01813(Tbio)
UniProt: Q01813
LinkDB All DBs
Structure
PDB: 

Position
10p15.2
AA seq 784 aa AA seqDB search
MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGIT
NLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMEC
VQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTK
RVLPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSICVL
GISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQ
PWSV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggacgactcccgggcccccaagggctccttgcggaagttcctggagcacctc
tccggggccggcaaggccatcggcgtgctgaccagcggcggggatgctcaaggtatgaac
gctgccgtccgtgccgtggtgcgcatgggtatctacgtgggggccaaggtgtacttcatc
tacgagggctaccagggcatggtggacggaggctcaaacatcgcagaggccgactgggag
agtgtctccagcatcctgcaagtgggcgggacgatcattggcagtgcgcggtgccaggcc
ttccgcacgcgggaaggccgcctgaaggctgcttgcaacctgctgcagcgcggcatcacc
aacctgtgtgtgatcggcggggacgggagcctcaccggggccaacctcttccggaaggag
tggagtgggctgctggaggagctggccaggaacggccagatcgataaggaggccgtgcag
aagtacgcctacctcaacgtggtgggcatggtgggctccatcgacaatgatttctgcggc
accgacatgaccatcggcacggactccgccctgcacaggatcatcgaggtcgtcgacgcc
atcatgaccacggcccagagccaccagaggaccttcgttctggaggtgatgggacgacac
tgtgggtacctggccctggtgagtgccttggcctgcggtgcggactgggtgttccttcca
gaatctccaccagaggaaggctgggaggagcagatgtgtgtcaaactctcggagaaccgt
gcccggaaaaaaaggctgaatattattattgtggctgaaggagcaattgatacccaaaat
aaacccatcacctctgagaaaatcaaagagcttgtcgtcacgcagctgggctatgacaca
cgtgtgaccatcctcgggcacgtgcagagaggagggaccccttcggcattcgacaggatc
ttggccagccgcatgggagtggaggcagtcatcgccttgctagaggccaccccggacacc
ccagcttgcgtcgtgtcactgaacgggaaccacgccgtgcgcctgccgctgatggagtgc
gtgcagatgactcaggatgtgcagaaggcgatggacgagaggagatttcaagatgcggtt
cgactccgagggaggagctttgcgggcaacctgaacacctacaagcgacttgccatcaag
ctgccggatgatcagatcccaaagaccaattgcaacgtagctgtcatcaacgtgggggca
cccgcggctgggatgaacgcagccgtacgctcagctgtgcgcgtgggcattgccgacggc
cacaggatgctcgccatctatgatggctttgacggcttcgccaagggccagatcaaagaa
atcggctggacagatgtcgggggctggaccggccaaggaggctccattcttgggacaaaa
cgcgttctcccggggaagtacttggaagagatcgccacacagatgcgcacgcacagcatc
aacgcgctgctgatcatcggtggattcgaggcctacctgggactcctggagctgtcagcc
gcccgggagaagcacgaggagttctgtgtccccatggtcatggttcccgctactgtgtcc
aacaatgtgccgggttccgatttcagcatcggggcagacaccgccctgaacactatcacc
gacacctgcgaccgcatcaagcagtccgccagcggaaccaagcggcgcgtgttcatcatc
gagaccatgggcggctactgtggctacctggccaacatgggggggctcgcggccggagct
gatgccgcatacattttcgaagagcccttcgacatcagggatctgcagtccaacgtggag
cacctgacggagaaaatgaagaccaccatccagagaggccttgtgctcagaaatgagagc
tgcagtgaaaactacaccaccgacttcatttaccagctgtattcagaagagggcaaaggc
gtgtttgactgcaggaagaacgtgctgggtcacatgcagcagggtggggcaccctctcca
tttgatagaaactttggaaccaaaatctctgccagagctatggagtggatcactgcaaaa
ctcaaggaggcccggggcagaggaaaaaaatttaccaccgatgattccatttgtgtgctg
ggaataagcaaaagaaacgttatttttcaacctgtggcagagctgaagaagcaaacggat
tttgagcacaggattcccaaagaacagtggtggctcaagctacggcccctcatgaaaatc
ctggccaagtacaaggccagctatgacgtgtcggactcaggccagctggaacatgtgcag
ccctggagtgtctga

DBGET integrated database retrieval system