Homo sapiens (human): 5217 Help Entry 5217              CDS       T01001                                  Symbol PFN2, D3S1319E, PFL Name (RefSeq) profilin 2   KO K05759   profilin Organism hsa  Homo sapiens (human) Pathway hsa04015   Rap1 signaling pathway hsa04810   Regulation of actin cytoskeleton hsa05014   Amyotrophic lateral sclerosis hsa05131   Shigellosis hsa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     5217 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     5217 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     5217 (PFN2)    05131 Shigellosis     5217 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     5217 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     5217 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     5217 (PFN2)    04147 Exosome [BR:hsa04147]     5217 (PFN2) Membrane trafficking [BR:hsa04131]  Others   Actin-binding proteins    Others     5217 (PFN2) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      5217 (PFN2) Exosome [BR:hsa04147]  Exosomal proteins   Proteins found in most exosomes    5217 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  5217 NCBI-ProteinID:  NP_002619 OMIM:  176590 HGNC:  8882 Ensembl:  ENSG00000070087 UniProt:  P35080 Structure PDB LinkDB All DBs Position 3:complement(149964904..149970895) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat gtggctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg taa

DBGET integrated database retrieval system