KEGG   Homo sapiens (human): 5255Help
Entry
5255              CDS       T01001                                 

Gene name
PHKA1, PHKA
Definition
(RefSeq) phosphorylase kinase regulatory subunit alpha 1
  KO
K07190  phosphorylase kinase alpha/beta subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
Disease
H00069  Glycogen storage disease
H01762  Muscle glycogen storage disease
H01948  Glycogen storage disease type IX
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5255 (PHKA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5255 (PHKA1)
   04922 Glucagon signaling pathway
    5255 (PHKA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 5255
NCBI-ProteinID: NP_002628
OMIM: 311870
HGNC: 8925
Ensembl: ENSG00000067177
Vega: OTTHUMG00000022696
Pharos: P46020(Tbio)
UniProt: P46020
LinkDB All DBs
Position
Xq13.1
AA seq 1223 aa AA seqDB search
MRSRSNSGVRLDGYARLVQQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLA
YRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQVDKVESFKYSQSTKDSLHAKYNTKT
CATVVGDDQWGHLQLDATSVYLLFLAQMTASGLHIIHSLDEVNFIQNLVFYIEAAYKTAD
FGIWERGDKTNQGISELNASSVGMAKAALEALDELDLFGVKGGPQSVIHVLADEVQHCQS
ILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSQLVELTKQEIITKLQGRYGCCRFLRDG
YKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFILDGVFSGNAEQVQEYKEALEAVLI
KGKNGVPLLPELYSVPPDRVDEEYQNPHTVDRVPMGKLPHMWGQSLYILGSLMAEGFLAP
GEIDPLNRRFSTVPKPDVVVQVSILAETEEIKTILKDKGIYVETIAEVYPIRVQPARILS
HIYSSLGCNNRMKLSGRPYRHMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNKMIV
EMLRTDLSYLCSRWRMTGQPTITFPISHSMLDEDGTSLNSSILAALRKMQDGYFGGARVQ
TGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDDNYDYLESGNWMNDYDSTSHARCGDEV
ARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPT
KLFQASRPSFNLLDSPHPRQENQVPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQA
DILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWGLIRYISGILRKKVEAL
DEACTDLLSHQKHLTVGLPPEPREKTISAPLPYEALTQLIDEASEGDMSISILTQEIMVY
LAMYMRTQPGLFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMKNLLHH
ILSGKEFGVERSVRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQVEFRRLSIS
AESQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFYQKVWKVLQ
KCHGLSVEGFVLPSSTTREMTPGEIKFSVHVESVLNRVPQPEYRQLLVEAILVLTMLADI
EIHSIGSIIAVEKIVHIANDLFLQEQKTLGADDTMLAKDPASGICTLLYDSAPSGRFGTM
TYLSKAAATYVQEFLPHSICAMQ
NT seq 3672 nt NT seq  +upstreamnt  +downstreamnt
atgaggagccggagtaactccggggtccggctggacggctacgctcgactggtgcaacag
accatcctgtgccatcagaatccagtgactggcttgcttccagccagctatgatcagaaa
gatgcttgggtccgagataatgtgtacagcatcttggctgtgtggggtttgggcctggcc
tatcggaagaatgcagaccgggatgaggataaggcaaaggcctatgaattggagcagagt
gtagtgaagctgatgagaggactactgcactgcatgatcagacaggtggataaagtagaa
tccttcaaatatagtcagagtactaaggatagcctccatgcaaagtacaacaccaaaacc
tgtgccactgtagtgggtgatgatcaatggggacacctgcagttggatgctacctctgtg
tacctgctcttcttagcccaaatgactgcctcaggactccatatcatccacagcctagat
gaagtcaatttcatacagaaccttgtgttttacattgaagctgcatataaaactgctgac
ttcgggatatgggaacgtggagacaagaccaaccaagggatctcagagttgaatgccagt
tcagttggaatggcaaaggcagccctggaagcattagatgaactggatctgtttggtgtg
aaaggtgggcctcaatcagttatccatgtcctggctgatgaagtacagcactgccagtct
atcctaaattcactactgccccgtgcttcaacatcaaaagaggttgatgctagtctactc
tcagtggtttccttccctgcctttgcagtagaggatagccagttggtggagctcacaaaa
caggaaatcatcaccaagcttcagggtcgttatggttgctgtcgctttctacgagatgga
tataaaactcctaaagaggatcccaatcgtctgtactatgaaccagctgagctgaagcta
tttgaaaacattgagtgtgaatggccattgttctggacatactttattcttgatggggtc
ttcagtggcaatgcagaacaggttcaagaatataaagaggctcttgaagcagtcctcatc
aagggcaaaaatggagtcccacttctgccagagctgtacagtgttcctcctgacagggtc
gatgaagaatatcagaatcctcacactgtggaccgagtccccatggggaaattgcctcac
atgtggggtcagtctctatacattttaggaagcttgatggcagagggatttttagcccct
ggagaaattgatcccctgaatcgcaggttttctactgtaccgaagcccgatgttgtggtt
caagtctccattctagctgaaacagaagaaatcaagaccattttgaaggacaagggaatt
tacgtggagaccattgctgaggtataccccatcagagtacaaccagctcgtattctcagc
cacatttattccagcctaggatgcaacaatagaatgaaactcagtggacgaccctacaga
cacatgggagtgcttggaacttcaaaactctatgacattcggaaaactatctttactttc
actccacagtttatagaccagcaacagttctacctggctctggacaacaagatgatagtg
gaaatgcttagaacagacctctcctacctctgtagccgctggcggatgacaggccagccc
accatcaccttccccatctcacacagcatgcttgatgaagatggaacaagcttgaattca
agtatcctggcagcactccgaaaaatgcaagatgggtattttggtggggcaagggttcaa
acaggtaaattgtcagagtttttgacaacatcttgttgcacacacttgagcttcatggac
cctggacctgagggtaagctgtacagtgaagattatgatgacaactatgattacctggaa
tctggcaactggatgaatgattatgattcaaccagtcatgctcgctgtggtgatgaagtt
gctcgttatttagatcaccttttggcgcacactgctccccatcctaaactagcccctacc
tcacagaagggagggctagatcggttccaagctgctgtgcaaacaacctgcgacttaatg
tccttggtgaccaaggccaaggaactgcatgtacagaatgttcacatgtatcttcctacg
aagttatttcaggcttcccggccttcattcaacttacttgattcacctcatccccgacag
gagaaccaggttccctctgttcgtgtagaaatacatcttcctagagaccagtctggggag
gtggactttaaagcactggttttacagttgaaggagacctcaagcttacaggaacaagct
gatatcctctatatgctgtatactatgaaaggacctgactggaacactgaattgtataat
gaacggagtgctacagtgagagagcttcttaccgagctgtatggcaaagtgggagaaatt
cgtcactggggcctgatccgatacatttctgggatcttaaggaagaaagtggaagcactt
gatgaggcctgcacagaccttctctcccaccagaaacatttgacagtaggacttcctcca
gaacctcgagaaaagactatctctgcacctctgccctatgaggcgctcactcagctgata
gatgaagccagtgaaggggatatgagcatttcaatccttacacaggaaataatggtatat
ctagccatgtatatgcgaacccagcctggcctctttgctgaaatgtttcgacttcgaatt
ggtctgatcatacaagttatggcaacagaactggcccactcccttcgatgctcagctgag
gaagccacagagggcctgatgaatctcagtccttcggccatgaagaatctcctgcatcac
attctcagcggcaaggagtttggagtggaacgaagcgttcgtcccactgattcaaatgtc
agtcctgctatttctatccacgagattggtgctgttggagcaaccaaaacagaacgaact
gggatcatgcagttaaaaagtgagataaagcaggtggaatttcgtagactgtcaatctca
gctgagagtcagtcacctggaacctctatgactccaagtagtgggtcctttcctagtgca
tatgatcagcagtcatctaaagatagtcgtcaaggtcaatggcaacgccgaagaaggctg
gatggggcactgaatagagttccagttggattttatcagaaagtatggaaagttttgcag
aagtgtcacggactttctgttgaagggtttgtccttccttcctctaccactagagagatg
actccaggtgagattaaattctctgttcatgtggagtctgtcctgaatcgtgtacctcag
ccagagtaccgtcagctgctggttgaagccatccttgtcctcaccatgctggcagatatt
gaaattcatagcatcggaagcatcattgctgtggaaaaaatagtgcatattgccaatgac
ttgttccttcaagaacagaaaacccttggcgcagatgataccatgttggcaaaggatccc
gcatctggcatctgtactcttctgtatgacagtgcacccagtggcaggtttggcaccatg
acctacctctccaaggcagccgccacctacgtgcaggagttcctgccccacagcatctgt
gccatgcaatga

KEGG   Homo sapiens (human): 5256Help
Entry
5256              CDS       T01001                                 

Gene name
PHKA2, GSD9A, PHK, PYK, PYKL, XLG, XLG2
Definition
(RefSeq) phosphorylase kinase regulatory subunit alpha 2
  KO
K07190  phosphorylase kinase alpha/beta subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
Disease
H00069  Glycogen storage disease
H01760  Hepatic glycogen storage disease
H01948  Glycogen storage disease type IX
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5256 (PHKA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5256 (PHKA2)
   04922 Glucagon signaling pathway
    5256 (PHKA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 5256
NCBI-ProteinID: NP_000283
OMIM: 300798
HGNC: 8926
Ensembl: ENSG00000044446
Vega: OTTHUMG00000021222
Pharos: P46019(Tbio)
UniProt: P46019
LinkDB All DBs
Position
Xp22.13
AA seq 1235 aa AA seqDB search
MRSRSNSGVRLDGYARLVQQTILCYQNPVTGLLSASHEQKDAWVRDNIYSILAVWGLGMA
YRKNADRDEDKAKAYELEQNVVKLMRGLLQCMMRQVAKVEKFKHTQSTKDSLHAKYNTAT
CGTVVGDDQWGHLQVDATSLFLLFLAQMTASGLRIIFTLDEVAFIQNLVFYIEAAYKVAD
YGMWERGDKTNQGIPELNASSVGMAKAALEAIDELDLFGAHGGRKSVIHVLPDEVEHCQS
ILFSMLPRASTSKEIDAGLLSIISFPAFAVEDVNLVNVTKNEIISKLQGRYGCCRFLRDG
YKTPREDPNRLHYDPAELKLFENIECEWPVFWTYFIIDGVFSGDAVQVQEYREALEGILI
RGKNGIRLVPELYAVPPNKVDEEYKNPHTVDRVPMGKVPHLWGQSLYILSSLLAEGFLAA
GEIDPLNRRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILS
HIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFTPQFTDQHHFYLALDNEMIV
EMLRIELAYLCTCWRMTGRPTLTFPISRTMLTNDGSDIHSAVLSTIRKLEDGYFGGARVK
LGNLSEFLTTSFYTYLTFLDPDCDEKLFDNASEGTFSPDSDSDLVGYLEDTCNQESQDEL
DHYINHLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDILSVMAKAKGLEVPFVPMTLPT
KVLSAHRKSLNLVDSPQPLLEKVPESDFQWPRDDHGDVDCEKLVEQLKDCSNLQDQADIL
YILYVIKGPSWDTNLSGQHGVTVQNLLGELYGKAGLNQEWGLIRYISGLLRKKVEVLAEA
CTDLLSHQKQLTVGLPPEPREKIISAPLPPEELTKLIYEASGQDISIAVLTQEIVVYLAM
YVRAQPSLFVEMLRLRIGLIIQVMATELARSLNCSGEEASESLMNLSPFDMKNLLHHILS
GKEFGVERSVRPIHSSTSSPTISIHEVGHTGVTKTERSGINRLRSEMKQMTRRFSADEQF
FSVGQAASSSAHSSKSARSSTPSSPTGTSSSDSGGHHIGWGERQGQWLRRRRLDGAINRV
PVGFYQRVWKILQKCHGLSIDGYVLPSSTTREMTPHEIKFAVHVESVLNRVPQPEYRQLL
VEAIMVLTLLSDTEMTSIGGIIHVDQIVQMASQLFLQDQVSIGAMDTLEKDQATGICHFF
YDSAPSGAYGTMTYLTRAVASYLQELLPNSGCQMQ
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
atgcggagcaggagcaattccggggtccgcttggacgggtacgcgcggctggtgcagcaa
accatcctgtgttaccagaatcccgtcacggggctgctgtcagccagccatgagcagaag
gatgcctgggtgcgggataacatctacagtatcctggccgtgtggggcctgggcatggcc
taccgtaagaatgcagaccgcgatgaggacaaggccaaggcctacgagctggagcagaac
gtggtgaagctgatgcgaggtcttctccagtgcatgatgagacaggtggccaaagtggag
aagttcaaacacactcagagcaccaaggacagcctgcacgccaagtacaacaccgccacc
tgtggcacggtggtgggcgacgaccagtggggccacctccaggtggatgccacctctctc
ttcctcctgttcctggcccagatgaccgcctcaggcttacgtatcattttcactctcgat
gaggtggccttcatacagaatcttgtcttttacatagaagctgcatataaagtcgctgat
tatggaatgtgggagcgtggagataagactaatcagggcatcccggaattgaatgcaagc
tccgtaggaatggccaaggcagctcttgaggcaattgatgaactggacctttttggagcc
catggaggacgcaagtcagtgattcatgttctgccagatgaggtcgagcactgccagtct
attctgttctccatgctgccaagagcgtcgacatctaaagaaattgatgctggacttctt
tccattatttccttcccggcctttgcagtggaagatgtaaaccttgtaaatgtgaccaaa
aatgaaattatttctaagctccaggggcgttatggatgctgtcgcttccttcgagatggt
tataaaactccaagagaggaccctaatcgactgcattatgaccctgctgaactcaagctc
ttcgaaaacattgaatgtgagtggcctgtgttttggacatattttataatagatggagtc
ttcagtggtgatgctgttcaggtccaagaataccgagaggccctggagggaatactcatc
agaggcaagaatgggatccgcctggtgcctgaactctacgctgtcccgcctaacaaggta
gatgaagagtacaagaatcctcacacagtagaccgagttcctatggggaaggtgcctcat
ctgtggggccaatccttgtacatcctcagctcgctgttggcagagggattccttgccgct
ggtgaaatcgatcccttaaatagaagattttccacttcagtcaaacctgatgttgtagta
caagttactgttttggcagaaaacaatcacattaaggacttattgaggaaacacggggtg
aacgtccagagtatcgcggacattcatccaattcaagtccagccgggccggattcttagt
cacatatatgccaagcttggacggaataagaatatgaatttgagtgggcgaccgtatcga
catattggtgtccttggaacctctaaactatatgtgattaggaaccaaatctttactttt
acaccccagttcaccgaccagcatcacttctacctggccctcgacaatgagatgatcgtg
gagatgctaaggatcgagctggcctacctgtgcacctgctggaggatgacgggcagaccc
acactcaccttccccatcagtcgcaccatgctcacaaatgatggctcagacattcattct
gctgtgctctccacaattagaaaactagaggatggatattttggaggagccagagtaaaa
ttagggaacctttcggaatttctcaccacatcgttctacacatatctgacttttctggat
ccagactgtgatgagaagttgtttgacaatgccagcgaagggactttcagtcctgatagt
gattcagatttggtaggatatctggaagacacctgtaatcaagaaagccaagacgaactt
gaccattatatcaaccaccttctgcaaagcacatcgttgaggtcctatctgcctcctctt
tgtaagaacacagaagaccgccatgtcttcagtgctatccactccacgcgggacatactt
tctgtgatggcaaaagcaaagggtttggaagttccatttgttcccatgactttgccgact
aaagttctaagtgcccaccgtaaatcactgaatcttgttgattctcctcagccactccta
gaaaaggttcctgaaagtgactttcagtggcccagagatgaccatggtgacgtggactgt
gagaagctggttgagcagctaaaagattgttcgaacctacaggaccaagcagacattctg
tacattctttatgtcataaagggtcccagctgggacacaaatctctctggacagcacggg
gtcaccgttcaaaaccttcttggtgagctctatgggaaagccggcttgaaccaggagtgg
ggtctgattcgctacatctcaggccttctcaggaagaaagtggaggtcctggctgaggcc
tgcacagacctgctttcgcaccagaagcagctcaccgtgggcctgccgcccgagccccgg
gagaagatcatctctgcgccccttcccccagaggagctcacaaaactcatctacgaggcc
agtgggcaggacatcagcattgccgtcctcacgcaggagattgtggtttacctggccatg
tatgtcagggcgcagcccagcctctttgtggagatgctgagactccggattggactgatc
attcaggtgatggccacggagctggcacggagcctgaactgctcaggagaagaggcttct
gaaagtttgatgaacctcagccctttcgatatgaaaaatctcctgcaccatattctaagt
gggaaagagtttggcgttgaaagaagtgtgcgccctatccactcctccacatccagccct
accatctccatccacgaggtgggccataccggagtcaccaaaactgagaggagtggcatt
aacagactgaggagtgaaatgaaacagatgactaggcggtttagtgctgatgaacagttc
ttttctgtgggccaggccgcgtccagcagtgcgcattcctccaagtctgcgaggtccagc
accccatcctcgcccactggcacgtcatcctcagactcgggaggacatcacatcggctgg
ggtgagcggcagggccagtggctgcgcaggagaaggctggatggggccatcaacagggtc
cccgtgggattctaccagagggtgtggaagatcctccagaagtgccacggtctctccatc
gatggttatgtcctcccatcctcgacgacccgagagatgaccccgcatgagatcaagttt
gctgtccatgtcgaatcggtgctgaaccgcgtgccgcagcccgagtaccggcagctgctg
gtggaagccatcatggtgctgacgctgctctcggacacggagatgaccagcatcgggggc
atcatccacgtggaccagatcgtgcagatggccagtcagctgttcttgcaggaccaggtg
tcaattggtgccatggacaccctggagaaagaccaagccacaggaatctgccacttcttt
tatgacagcgctccgagtggggcttatgggacgatgacctacctaacaagagcagtggct
tcttatttgcaggaattgttgcccaattcgggctgccagatgcaatag

KEGG   Homo sapiens (human): 5257Help
Entry
5257              CDS       T01001                                 

Gene name
PHKB
Definition
(RefSeq) phosphorylase kinase regulatory subunit beta
  KO
K07190  phosphorylase kinase alpha/beta subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
Disease
H00069  Glycogen storage disease
H01760  Hepatic glycogen storage disease
H01948  Glycogen storage disease type IX
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5257 (PHKB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5257 (PHKB)
   04922 Glucagon signaling pathway
    5257 (PHKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 5257
NCBI-ProteinID: NP_000284
OMIM: 172490
HGNC: 8927
Ensembl: ENSG00000102893
Vega: OTTHUMG00000133102
Pharos: Q93100(Tbio)
UniProt: Q93100
LinkDB All DBs
Position
16q12.1
AA seq 1093 aa AA seqDB search
MAGAAGLTAEVSWKVLERRARTKRSGSVYEPLKSINLPRPDNETLWDKLDHYYRIVKSTL
LLYQSPTTGLFPTKTCGGDQKAKIQDSLYCAAGAWALALAYRRIDDDKGRTHELEHSAIK
CMRGILYCYMRQADKVQQFKQDPRPTTCLHSVFNVHTGDELLSYEEYGHLQINAVSLYLL
YLVEMISSGLQIIYNTDEVSFIQNLVFCVERVYRVPDFGVWERGSKYNNGSTELHSSSVG
LAKAALEAINGFNLFGNQGCSWSVIFVDLDAHNRNRQTLCSLLPRESRSHNTDAALLPCI
SYPAFALDDEVLFSQTLDKVVRKLKGKYGFKRFLRDGYRTSLEDPNRCYYKPAEIKLFDG
IECEFPIFFLYMMIDGVFRGNPKQVQEYQDLLTPVLHHTTEGYPVVPKYYYVPADFVEYE
KNNPGSQKRFPSNCGRDGKLFLWGQALYIIAKLLADELISPKDIDPVQRYVPLKDQRNVS
MRFSNQGPLENDLVVHVALIAESQRLQVFLNTYGIQTQTPQQVEPIQIWPQQELVKAYLQ
LGINEKLGLSGRPDRPIGCLGTSKIYRILGKTVVCYPIIFDLSDFYMSQDVFLLIDDIKN
ALQFIKQYWKMHGRPLFLVLIREDNIRGSRFNPILDMLAALKKGIIGGVKVHVDRLQTLI
SGAVVEQLDFLRISDTEELPEFKSFEELEPPKHSKVKRQSSTPSAPELGQQPDVNISEWK
DKPTHEILQKLNDCSCLASQAILLGILLKREGPNFITKEGTVSDHIERVYRRAGSQKLWL
AVRYGAAFTQKFSSSIAPHITTFLVHGKQVTLGAFGHEEEVISNPLSPRVIQNIIYYKCN
THDEREAVIQQELVIHIGWIISNNPELFSGMLKIRIGWIIHAMEYELQIRGGDKPALDLY
QLSPSEVKQLLLDILQPQQNGRCWLNRRQIDGSLNRTPTGFYDRVWQILERTPNGIIVAG
KHLPQQPTLSDMTMYEMNFSLLVEDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQD
KVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEG
EVKPNNDDPCLIS
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcggcgggactcacggcagaagtgagctggaaggtcttggagcgaagagct
cggaccaagcgctcaggctcagtttatgaacctcttaaaagcattaatcttccaagacct
gataatgaaactctctgggataagttggaccattattacagaattgtcaagtcaacattg
ctgctgtatcaaagtccaactaccggtctctttcccactaaaacatgcggtggtgaccag
aaggccaagatccaggacagcctatactgcgctgctggggcctgggctttggctcttgca
tacaggcgaattgatgatgacaagggaaggacccatgagctggagcactcagctataaaa
tgcatgagaggaattctctactgctatatgcgtcaggccgataaggtccagcagtttaag
caggatccacgcccaacaacatgtcttcactctgttttcaatgtgcatacaggagatgag
ttgctttcctatgaggaatatggtcatcttcagataaatgcagtgtcactttatctcctt
taccttgtggaaatgatttcctcaggactccagattatctacaacactgatgaggtctct
tttattcaaaaccttgtattttgtgtggaaagagtttaccgtgtgcctgactttggtgtc
tgggaaagaggaagcaaatataataatggcagcacagagctacattcgagctcggttggt
ttagcaaaagcagctctagaagcaattaatggattcaacctttttggcaaccagggctgt
tcgtggtcagttatatttgtggatctcgatgctcacaatcgcaacaggcaaactttgtgc
tcgctgttacccagagaatcaagatcacataatacagatgctgccctgctcccctgcatc
agttatcctgcatttgccctggatgatgaagttctttttagccagacacttgataaagtg
gttagaaaattaaaaggaaaatatggatttaaacgtttcttgagagatgggtatagaaca
tcattggaagatcccaacagatgctactacaagccagctgaaattaagctatttgatggc
attgaatgtgaatttcccatatttttcctttatatgatgattgatggagtttttagaggc
aatcctaagcaagtacaggaatatcaggatcttttgactccagtacttcatcataccaca
gaaggatatcctgttgtaccaaagtactattatgtgccagctgactttgtagaatatgaa
aaaaataaccctggtagtcaaaaacgatttcctagcaactgtggccgtgatggaaaactg
tttctttggggacaagcactttatatcatcgcaaaactcctggctgatgaacttattagt
cctaaagacattgatcctgtccagcgctatgtcccactaaaggatcaacgtaacgtgagc
atgaggttttccaatcagggcccactggaaaatgacttggtagttcatgtggcacttata
gcagaaagccaaagacttcaagtttttctgaacacatatggtattcaaactcaaactcct
caacaagtagaacccattcagatatggcctcagcaggagcttgtgaaagcttatttgcag
ctgggtatcaatgaaaagttaggactctctggaaggccagacaggcccattggctgcctc
gggacatcaaagatttatcgcattctaggaaagactgtggtttgttacccgattattttc
gacctaagtgatttctacatgtctcaggatgttttcctgctgatagatgacataaagaat
gcgctgcagttcattaaacaatattggaaaatgcatggacgtccacttttccttgttctc
atccgggaagacaatataagaggtagccggttcaaccccatattagatatgctggcagcc
cttaaaaaaggaataattggaggagtcaaagttcatgtggatcgtctacagacactaata
tctggagctgtggtagaacaacttgatttcctacgaatcagtgacacagaagagcttcca
gaatttaagagttttgaggaactagaacctcccaaacattcaaaagtcaaacggcaaagc
agcacccctagtgctcctgaactgggacagcagccggatgtcaacattagtgaatggaag
gacaaacccacccacgaaattcttcaaaaactgaatgattgcagttgtctggctagccaa
gccatcctgctgggtatactgctcaaaagagaaggccccaacttcatcacaaaggaaggt
accgtttctgatcacattgagagagtctatagaagagctggcagccaaaaactttggttg
gcggtgcgctacggggctgcatttacccagaaattttcttcctctatagccccacacatt
actacttttctggtacatgggaaacaggtaactctgggtgcctttgggcatgaagaagaa
gttatctctaatcctttgtctccaagagtgattcaaaacatcatctattataagtgtaac
acccatgatgagagggaagcggtcattcagcaagaactggtcatccatattggctggatc
atctccaataaccctgagttattcagtggcatgctgaaaatacgaatcgggtggatcatc
catgccatggagtatgaacttcagatccgtggcggagacaagccagccttggacttgtat
cagctgtcacctagtgaagttaaacagcttctgctggatattctgcagcctcaacagaat
ggaagatgttggctgaacaggcgtcagatcgatgggtctttgaatagaactcccaccggg
ttctatgaccgagtgtggcagattctggagcgcacgcccaatgggatcattgttgctggg
aagcatttgcctcagcaaccaaccctgtcagatatgaccatgtatgagatgaatttctct
ctccttgttgaagacacgttgggaaatattgaccagccacagtacagacagatcgttgta
gagttacttatggttgtatccattgtactggaaagaaaccccgagctagaatttcaagac
aaagtagatctagacagactggtcaaagaagcatttaatgaatttcaaaaagatcagagt
cggctaaaggaaattgaaaaacaagatgacatgacttccttttacaacactcctcccctg
ggaaaaagaggaacatgcagctatttgacaaaggcggtgatgaatctgctgctggaagga
gaagtcaagccaaacaatgatgacccgtgtctgattagctag

KEGG   Homo sapiens (human): 5260Help
Entry
5260              CDS       T01001                                 

Gene name
PHKG1, PHKG
Definition
(RefSeq) phosphorylase kinase catalytic subunit gamma 1
  KO
K00871  phosphorylase kinase gamma subunit [EC:2.7.11.19]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5260 (PHKG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5260 (PHKG1)
   04922 Glucagon signaling pathway
    5260 (PHKG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5260 (PHKG1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.19  phosphorylase kinase
     5260 (PHKG1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PHK family
   5260 (PHKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo APH Spc110_C Pkinase_fungal FTA2 RIO1 Choline_kinase YukC
Motif
Other DBs
NCBI-GeneID: 5260
NCBI-ProteinID: NP_006204
OMIM: 172470
HGNC: 8930
Ensembl: ENSG00000164776
Vega: OTTHUMG00000023869
Pharos: Q16816(Tchem)
UniProt: Q16816 A0A024RDL4
LinkDB All DBs
Position
7p11.2
AA seq 387 aa AA seqDB search
MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFS
PEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLSEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGER
LREVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFS
PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEDY
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggacgaggcactgccggactctcattctgcacaggacttctatgagaattat
gagcccaaagagatcctgggcaggggcgttagcagtgtggtcaggcgatgcatccacaag
cccacgagccaggagtacgccgtgaaggtcatcgacgtcaccggtggaggcagcttcagc
ccggaggaggtgcgggagctgcgagaagccacgctgaaggaggtggacatcctgcgcaag
gtctcagggcaccccaacatcatacagctgaaggacacttatgagaccaacactttcttc
ttcttggtgtttgacctgatgaagagaggggagctctttgactacctcactgagaaggtc
accttgagtgagaaggaaaccagaaagatcatgcgagctctgctggaggtgatctgcacc
ttgcacaaactcaacatcgtgcaccgggacctgaagcccgagaacattctcttggatgac
aacatgaacatcaagctcacagactttggcttttcctgccagctggagccgggagagagg
ctgcgagaggtctgcgggacccccagttacctggcccctgagattatcgagtgctccatg
aatgaggaccacccgggctacgggaaagaggtggacatgtggagcactggcgtcatcatg
tacacgctgctggccggctccccgcccttctggcaccggaagcagatgctgatgctgagg
atgatcatgagcggcaactaccagtttggctcgcccgagtgggatgattactcggacacc
gtgaaggacctggtctcccgattcctggtggtgcaaccccagaaccgctacacagcggaa
gaggccttggcacaccccttcttccagcagtacttggtggaggaagtgcggcacttcagc
ccccgggggaagttcaaggtgatcgctctgaccgtgctggcttcagtgcggatctactac
cagtaccgccgggtgaagcctgtgacccgggagatcgtcatccgagacccctatgccctc
cggcctctgcgccggctcatcgacgcctacgctttccgaatctatggccactgggtgaag
aaggggcagcagcagaaccgggcagcccttttcgagaacacacccaaggccgtgctcctc
tccctggccgaggaggactactga

KEGG   Homo sapiens (human): 5261Help
Entry
5261              CDS       T01001                                 

Gene name
PHKG2, GSD9C
Definition
(RefSeq) phosphorylase kinase catalytic subunit gamma 2
  KO
K00871  phosphorylase kinase gamma subunit [EC:2.7.11.19]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
Disease
H00069  Glycogen storage disease
H01760  Hepatic glycogen storage disease
H01948  Glycogen storage disease type IX
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5261 (PHKG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5261 (PHKG2)
   04922 Glucagon signaling pathway
    5261 (PHKG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5261 (PHKG2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.19  phosphorylase kinase
     5261 (PHKG2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PHK family
   5261 (PHKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal APH RIO1 Haspin_kinase Choline_kinase DUF2805 Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 5261
NCBI-ProteinID: NP_000285
OMIM: 172471
HGNC: 8931
Ensembl: ENSG00000156873
Vega: OTTHUMG00000132400
Pharos: P15735(Tchem)
UniProt: P15735
LinkDB All DBs
Structure
PDB: 

Position
16p11.2
AA seq 406 aa AA seqDB search
MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAE
RLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLT
EKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEP
GEKLRELCGTPGYLAPEILKCSMDETHPGYGKEVDLWACGVILFTLLAGSPPFWHRRQIL
MLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQALQHPFFERCEGSQPW
NLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLYGH
WVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggacgtggggccggaggatgagctgcccgactgggccgccgccaaagagttt
taccagaagtacgaccctaaggacgtcatcggcagaggagtgagctctgtggtccgccgt
tgtgttcatcgagctactggccacgagtttgcggtgaagattatggaagtgacagctgag
cggctgagtcctgagcagctggaggaggtgcgggaagccacacggcgagagacacacatc
cttcgccaggtcgccggccacccccacatcatcaccctcatcgattcctacgagtcttct
agcttcatgttcctggtgtttgacctgatgcggaagggagagctgtttgactatctcaca
gagaaggtggccctctctgaaaaggaaaccaggtccatcatgcggtctctgctggaagca
gtgagctttctccatgccaacaacattgtgcatcgagatctgaagcccgagaatattctc
ctagatgacaatatgcagatccgactttcagatttcgggttctcctgccacttggaacct
ggcgagaagcttcgagagttgtgtgggaccccagggtatctagcgccagagatccttaaa
tgctccatggatgaaacccacccaggctatggcaaggaggtcgacctctgggcctgtggg
gtgatcttgttcacactcctggctggctcgccacccttctggcaccggcggcagatcctg
atgttacgcatgatcatggagggccagtaccagttcagttcccccgagtgggatgaccgt
tccagcactgtcaaagacctgatctccaggctgctgcaggtggatcctgaggcacgcctg
acagctgagcaggccctacagcaccccttctttgagcgttgtgaaggcagccaaccctgg
aacctcaccccccgccagcggttccgggtggcagtgtggacagtgctggctgctggacga
gtggccctaagcacccatcgtgtacggccactgaccaagaatgcactgttgagggaccct
tatgcgctgcggtcagtgcggcacctcatcgacaactgtgccttccggctctacgggcac
tgggtaaagaaaggggagcagcagaaccgggcggctctctttcagcaccggccccctggg
ccttttcccatcatgggccctgaagaggagggagactctgctgctataactgaggatgag
gccgtgcttgtgctgggctag

DBGET integrated database retrieval system