KEGG   Homo sapiens (human): 5268
Entry
5268              CDS       T01001                                 

Gene name
SERPINB5, PI5, maspin
Definition
(RefSeq) serpin family B member 5
  KO
K10139  serpin B5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    5268 (SERPINB5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    5268 (SERPINB5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5268 (SERPINB5)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   5268 (SERPINB5)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 5268
NCBI-ProteinID: NP_002630
OMIM: 154790
HGNC: 8949
Ensembl: ENSG00000206075
Vega: OTTHUMG00000141307
Pharos: P36952(Tbio)
UniProt: P36952 A0A024R2B6
LinkDB
Structure
PDB: 
1WZ9 1XU8 1XQG 1XQJ

Position
18q21.33
AA seq 375 aa
MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHF
ENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVD
FKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESET
KECPFRVNKTDTKPVQMMNMEATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDES
TGLEKIEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSED
TSDFSGMSETKGVALSNVIHKVCLEITEDGGDSIEVPGARILQHKDELNADHPFIYIIRH
NKTRNIIFFGKFCSP
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgccctgcaactagcaaattcggcttttgccgttgatctgttcaaacaactatgt
gaaaaggagccactgggcaatgtcctcttctctccaatctgtctctccacctctctgtca
cttgctcaagtgggtgctaaaggtgacactgcaaatgaaattggacaggttcttcatttt
gaaaatgtcaaagatgtaccctttggatttcaaacagtaacatcggatgtaaacaaactt
agttccttttactcactgaaactaatcaagcggctctacgtagacaaatctctgaatctt
tctacagagttcatcagctctacgaagagaccgtatgcaaaggaattggaaactgttgac
ttcaaagataaattggaagaaacgaaaggtcagatcaacaactcaattaaggatctcaca
gatggccactttgagaacattttagctgacaacagtgtgaacgaccagaccaaaatcctt
gtggttaatgctgcctactttgttggcaagtggatgaagaaattttctgaatcagaaaca
aaagaatgtcctttcagagtcaacaagacagacaccaaaccagtgcagatgatgaacatg
gaggccacgttctgtatgggaaacattgacagtatcaattgtaagatcatagagcttcct
tttcaaaataagcatctcagcatgttcatcctactacccaaggatgtggaggatgagtcc
acaggcttggagaagattgaaaaacaactcaactcagagtcactgtcacagtggactaat
cccagcaccatggccaatgccaaggtcaaactctccattccaaaatttaaggtggaaaag
atgattgatcccaaggcttgtctggaaaatctagggctgaaacatatcttcagtgaagac
acatctgatttctctggaatgtcagagaccaagggagtggccctatcaaatgttatccac
aaagtgtgcttagaaataactgaagatggtggggattccatagaggtgccaggagcacgg
atcctgcagcacaaggatgaattgaatgctgaccatccctttatttacatcatcaggcac
aacaaaactcgaaacattattttctttggcaaattctgttctccttaa

DBGET integrated database retrieval system