KEGG   Homo sapiens (human): 5279Help
Entry
5279              CDS       T01001                                 

Gene name
PIGC, GPI2, GPIBD16, MRT62
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class C
  KO
K03859  phosphatidylinositol N-acetylglucosaminyltransferase subunit C
Organism
hsa  Homo sapiens (human)
Pathway
hsa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00065  GPI-anchor biosynthesis, core oligosaccharide
Network
nt06018  GPI-anchor biosynthesis
  Element
N00748  GPI-anchor biosynthesis
N00749  PGAP1 deficiency in GPI-anchor biosynthesis
N00750  PIGT deficiency in GPI-anchor biosynthesis
N00751  PIGO deficiency in GPI-anchor biosynthesis
N00752  PIGN deficiency in GPI-anchor biosynthesis
N00753  PIGV deficiency in GPI-anchor biosynthesis
N00754  PIGM deficiency in GPI-anchor biosynthesis
N00755  PIGW deficiency in GPI-anchor biosynthesis
N00756  PIGL deficiency in GPI-anchor biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    5279 (PIGC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GPI2
Motif
Other DBs
NCBI-GeneID: 5279
NCBI-ProteinID: NP_002633
OMIM: 601730
HGNC: 8960
Ensembl: ENSG00000135845
Vega: OTTHUMG00000034751
Pharos: Q92535(Tbio)
UniProt: Q92535
LinkDB All DBs
Position
1q24.3
AA seq 297 aa AA seqDB search
MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQ
QLCSVCVFVVIWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADL
KSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLN
MAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSAV
GGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtatgctcaacctgtgactaacaccaaggaggtcaagtggcagaaggtcttgtatgag
cgacagccctttcctgataactatgtggaccggcgattcctggaagagctccggaaaaac
atccatgctcggaaataccaatattgggctgtggtatttgagtccagtgtggtgatccag
cagctgtgcagtgtttgtgtttttgtggttatctggtggtatatggatgagggtcttctg
gccccccattggcttttagggactggtctggcttcttcactgattgggtatgttttgttt
gatctcattgatggaggtgaagggcggaagaagagtgggcagacccggtgggctgacctg
aagagtgccctagtcttcattactttcacttatgggttttcaccagtgctgaagaccctt
acagagtctgtcagcactgacaccatctatgccatgtcagtcttcatgctgttaggccat
ctcatcttttttgactatggtgccaatgctgccattgtatccagcacactatccttgaac
atggccatctttgcttctgtatgcttggcatcacgtcttccccggtccctgcatgccttc
atcatggtgacatttgccattcagatttttgccctgtggcccatgttgcagaagaaacta
aaggcatgtactccccggagctatgtgggggtcacactgctttttgcattttcagccgtg
ggaggcctactgtccattagtgctgtgggagccgtactctttgcccttctgctgatgtct
atctcatgtctgtgtccattctacctcattcgcttgcagctttttaaagaaaacattcat
gggccttgggatgaagctgaaatcaaggaagacttgtccaggttcctcagttaa

DBGET integrated database retrieval system