KEGG   Homo sapiens (human): 5296
Entry
5296              CDS       T01001                                 

Gene name
PIK3R2, MPPH, MPPH1, P85B, p85, p85-BETA
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04218  Cellular senescence
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04722  Neurotrophin signaling pathway
hsa04725  Cholinergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04926  Relaxin signaling pathway
hsa04929  GnRH secretion
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04973  Carbohydrate digestion and absorption
hsa05010  Alzheimer disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease
hsa05146  Amoebiasis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05418  Fluid shear stress and atherosclerosis
Disease
H01885  Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    5296 (PIK3R2)
   04014 Ras signaling pathway
    5296 (PIK3R2)
   04015 Rap1 signaling pathway
    5296 (PIK3R2)
   04370 VEGF signaling pathway
    5296 (PIK3R2)
   04630 JAK-STAT signaling pathway
    5296 (PIK3R2)
   04668 TNF signaling pathway
    5296 (PIK3R2)
   04066 HIF-1 signaling pathway
    5296 (PIK3R2)
   04068 FoxO signaling pathway
    5296 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    5296 (PIK3R2)
   04072 Phospholipase D signaling pathway
    5296 (PIK3R2)
   04071 Sphingolipid signaling pathway
    5296 (PIK3R2)
   04024 cAMP signaling pathway
    5296 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    5296 (PIK3R2)
   04152 AMPK signaling pathway
    5296 (PIK3R2)
   04150 mTOR signaling pathway
    5296 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5296 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    5296 (PIK3R2)
   04218 Cellular senescence
    5296 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5296 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    5296 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5296 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5296 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    5296 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    5296 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    5296 (PIK3R2)
   04660 T cell receptor signaling pathway
    5296 (PIK3R2)
   04662 B cell receptor signaling pathway
    5296 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    5296 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    5296 (PIK3R2)
   04670 Leukocyte transendothelial migration
    5296 (PIK3R2)
   04062 Chemokine signaling pathway
    5296 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5296 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    5296 (PIK3R2)
   04929 GnRH secretion
    5296 (PIK3R2)
   04915 Estrogen signaling pathway
    5296 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    5296 (PIK3R2)
   04917 Prolactin signaling pathway
    5296 (PIK3R2)
   04926 Relaxin signaling pathway
    5296 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    5296 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    5296 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    5296 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5296 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    5296 (PIK3R2)
   04722 Neurotrophin signaling pathway
    5296 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5296 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    5296 (PIK3R2)
   04380 Osteoclast differentiation
    5296 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    5296 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    5296 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5296 (PIK3R2)
   05206 MicroRNAs in cancer
    5296 (PIK3R2)
   05205 Proteoglycans in cancer
    5296 (PIK3R2)
   05203 Viral carcinogenesis
    5296 (PIK3R2)
   05230 Central carbon metabolism in cancer
    5296 (PIK3R2)
   05231 Choline metabolism in cancer
    5296 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5296 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5296 (PIK3R2)
   05212 Pancreatic cancer
    5296 (PIK3R2)
   05225 Hepatocellular carcinoma
    5296 (PIK3R2)
   05226 Gastric cancer
    5296 (PIK3R2)
   05214 Glioma
    5296 (PIK3R2)
   05221 Acute myeloid leukemia
    5296 (PIK3R2)
   05220 Chronic myeloid leukemia
    5296 (PIK3R2)
   05218 Melanoma
    5296 (PIK3R2)
   05211 Renal cell carcinoma
    5296 (PIK3R2)
   05215 Prostate cancer
    5296 (PIK3R2)
   05213 Endometrial cancer
    5296 (PIK3R2)
   05224 Breast cancer
    5296 (PIK3R2)
   05222 Small cell lung cancer
    5296 (PIK3R2)
   05223 Non-small cell lung cancer
    5296 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5296 (PIK3R2)
   05017 Spinocerebellar ataxia
    5296 (PIK3R2)
   05020 Prion disease
    5296 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5296 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5296 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    5296 (PIK3R2)
   04931 Insulin resistance
    5296 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5296 (PIK3R2)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    5296 (PIK3R2)
   05135 Yersinia infection
    5296 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    5296 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5296 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    5296 (PIK3R2)
   05161 Hepatitis B
    5296 (PIK3R2)
   05160 Hepatitis C
    5296 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    5296 (PIK3R2)
   05164 Influenza A
    5296 (PIK3R2)
   05162 Measles
    5296 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    5296 (PIK3R2)
   05163 Human cytomegalovirus infection
    5296 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5296 (PIK3R2)
   05169 Epstein-Barr virus infection
    5296 (PIK3R2)
   05165 Human papillomavirus infection
    5296 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5296 (PIK3R2)
   05142 Chagas disease
    5296 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    5296 (PIK3R2)
   01524 Platinum drug resistance
    5296 (PIK3R2)
   01522 Endocrine resistance
    5296 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5296 (PIK3R2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    5296 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e Tai4 ATG11
Other DBs
NCBI-GeneID: 5296
NCBI-ProteinID: NP_005018
OMIM: 603157
HGNC: 8980
Ensembl: ENSG00000105647
Vega: OTTHUMG00000183383
Pharos: O00459(Tbio)
UniProt: O00459
LinkDB
Structure
PDB: 
3O5Z 2XS6 3MTT 2KT1

Position
19p13.11
AA seq 728 aa
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLA
LPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVASRAPALG
PAVRALGATFGPLLLRAPPPPSSPPPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVAPP
ALPPKPPKAKPASTVLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSK
IQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTR
LLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTA
IEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRT
KLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNE
TEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVV
VDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPG
PGPPPAAR
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggcgggccctgagggcttccagtaccgcgctctgtacccgttccgccgggagcggccg
gaggacctggagctgctgcccggcgacgtgctggtagtgagccgggcggccttgcaggcg
ctgggcgtggccgagggtggcgagcgctgcccacagagcgtgggctggatgcccggcctc
aacgagcgcacacggcagcgaggtgacttccctggcacctatgtggagttcctggggccc
gtggccctggcccggcccggccctcgcccacggggcccccgcccactgcccgccaggccc
cgtgatggggcccctgagccaggcctcacactccccgacttgcccgagcagttctcccca
cctgatgtggctccccctcttctggtgaagcttgtggaggccattgaaaggacagggctg
gacagcgaatctcactaccgcccggagctgcccgcaccgcgtacagactggtccctgagc
gacgtggatcagtgggacacggcagccctggctgacggcattaagagcttcctgctggca
ctgcccgcgccgctcgtgacccccgaggcctcggccgaggcgcgccgggccctgcgggag
gccgcggggcccgtggggccggcgctggagccaccgacgctgccgctgcaccgcgcgctc
acgctgcgcttcctgctccagcacctgggccgcgtggccagccgcgccccggccctgggt
cccgcggtccgggccctgggcgccacctttgggccgctgctgctgcgcgcgccgccgccg
ccgtcctcgccgccgccagggggcgctcccgacgggagtgagcccagccctgacttcccg
gcgctgctggtggagaagctgcttcaggaacacttggaagagcaggaggttgcgccccca
gcgctgccgcctaaaccccccaaggcaaagccggcctccacagtcctggccaatggaggg
agcccaccctccctgcaggatgctgagtggtactggggggacatttcaagggaggaggtg
aacgagaaactccgggacactcccgatggcaccttcctagtccgagatgcttctagcaag
atccagggcgagtacacgctgaccctcaggaaaggcgggaacaataagctgatcaaggtc
ttccaccgagatgggcactatggcttctcagagccactcaccttctgctccgttgtggac
ctcatcaatcactaccgccacgagtctctggcccagtacaatgccaagctggacacacgg
ctcctctaccctgtgtccaaataccagcaggaccagattgtcaaggaggacagcgtggag
gcagtgggcgcccagcttaaggtctatcaccagcagtaccaggacaagagccgcgagtat
gaccagctttatgaagagtacacacggacctcccaggagctgcagatgaagcgtactgca
attgaggccttcaatgagactatcaagatctttgaagagcagggccagactcaagagaaa
tgcagcaaggaatacctggagcgcttccggcgtgagggcaacgagaaagagatgcaaagg
atcctgctgaactccgagcggctcaagtcccgcattgccgagatccatgagagccgcacg
aagctggagcagcagctgcgggcccaggcctcggacaacagagagatcgacaagcgcatg
aacagcctcaagccggacctcatgcagctgcgcaagatccgagaccagtacctcgtgtgg
ctcacccagaaaggcgcccggcagaagaaaatcaacgagtggctggggattaaaaatgag
actgaggaccagtacgcactcatggaggacgaggacgatctcccgcaccacgaggaacgc
acttggtacgtgggcaagatcaaccgcacgcaggcagaggagatgctgagtggcaagcgg
gatggcaccttcctcatccgcgagagcagccagcggggctgctacgcctgctccgtggta
gtggacggcgacaccaagcactgcgtcatctaccgcacggccaccggcttcggcttcgcg
gagccctacaacctgtacgggtcgctgaaggagctggtgctgcactaccagcacgcctcg
ctggtgcagcacaacgacgcgctcaccgtcaccctggcgcacccagtgcgcgccccgggc
cccggcccgccgcctgccgcccgctga

DBGET integrated database retrieval system