KEGG   Homo sapiens (human): 5328Help
Entry
5328              CDS       T01001                                 

Gene name
PLAU, ATF, BDPLT5, QPD, UPA, URK, u-PA
Definition
(RefSeq) plasminogen activator, urokinase
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04610  Complement and coagulation cascades
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
Network
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00128  TMPRSS2-ERG fusion to transcriptional activation
N00130  TMPRSS2-ETV5 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    5328 (PLAU)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    5328 (PLAU)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    5328 (PLAU)
   05206 MicroRNAs in cancer
    5328 (PLAU)
   05205 Proteoglycans in cancer
    5328 (PLAU)
  09162 Cancer: specific types
   05215 Prostate cancer
    5328 (PLAU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    5328 (PLAU)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5328 (PLAU)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     5328 (PLAU)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5328 (PLAU)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis
   5328 (PLAU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Kringle DUF316 Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 5328
NCBI-ProteinID: NP_002649
OMIM: 191840
HGNC: 9052
Ensembl: ENSG00000122861
Vega: OTTHUMG00000018494
Pharos: P00749(Tchem)
UniProt: P00749 A0A024QZM9 Q59GZ8
LinkDB All DBs
Structure
PDB: 

Position
10q22.2
AA seq 431 aa AA seqDB search
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagagccctgctggcgcgcctgcttctctgcgtcctggtcgtgagcgactccaaaggc
agcaatgaacttcatcaagttccatcgaactgtgactgtctaaatggaggaacatgtgtg
tccaacaagtacttctccaacattcactggtgcaactgcccaaagaaattcggagggcag
cactgtgaaatagataagtcaaaaacctgctatgaggggaatggtcacttttaccgagga
aaggccagcactgacaccatgggccggccctgcctgccctggaactctgccactgtcctt
cagcaaacgtaccatgcccacagatctgatgctcttcagctgggcctggggaaacataat
tactgcaggaacccagacaaccggaggcgaccctggtgctatgtgcaggtgggcctaaag
ccgcttgtccaagagtgcatggtgcatgactgcgcagatggaaaaaagccctcctctcct
ccagaagaattaaaatttcagtgtggccaaaagactctgaggccccgctttaagattatt
gggggagaattcaccaccatcgagaaccagccctggtttgcggccatctacaggaggcac
cgggggggctctgtcacctacgtgtgtggaggcagcctcatcagcccttgctgggtgatc
agcgccacacactgcttcattgattacccaaagaaggaggactacatcgtctacctgggt
cgctcaaggcttaactccaacacgcaaggggagatgaagtttgaggtggaaaacctcatc
ctacacaaggactacagcgctgacacgcttgctcaccacaacgacattgccttgctgaag
atccgttccaaggagggcaggtgtgcgcagccatcccggactatacagaccatctgcctg
ccctcgatgtataacgatccccagtttggcacaagctgtgagatcactggctttggaaaa
gagaattctaccgactatctctatccggagcagctgaaaatgactgttgtgaagctgatt
tcccaccgggagtgtcagcagccccactactacggctctgaagtcaccaccaaaatgctg
tgtgctgctgacccacagtggaaaacagattcctgccagggagactcagggggacccctc
gtctgttccctccaaggccgcatgactttgactggaattgtgagctggggccgtggatgt
gccctgaaggacaagccaggcgtctacacgagagtctcacacttcttaccctggatccgc
agtcacaccaaggaagagaatggcctggccctctga

KEGG   Homo sapiens (human): 5327Help
Entry
5327              CDS       T01001                                 

Gene name
PLAT, T-PA, TPA
Definition
(RefSeq) plasminogen activator, tissue type
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
hsa04610  Complement and coagulation cascades
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00128  TMPRSS2-ERG fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5327 (PLAT)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    5327 (PLAT)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    5327 (PLAT)
  09162 Cancer: specific types
   05215 Prostate cancer
    5327 (PLAT)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5327 (PLAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    5327 (PLAT)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5327 (PLAT)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     5327 (PLAT)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5327 (PLAT)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis
   5327 (PLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Kringle fn1 EGF Trypsin_2 DUF1986 hEGF
Motif
Other DBs
NCBI-GeneID: 5327
NCBI-ProteinID: NP_000921
OMIM: 173370
HGNC: 9051
Ensembl: ENSG00000104368
Vega: OTTHUMG00000164072
Pharos: P00750(Tclin)
UniProt: P00750
LinkDB All DBs
Structure
PDB: 

Position
8p11.21
AA seq 562 aa AA seqDB search
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaatgaagagagggctctgctgtgtgctgctgctgtgtggagcagtcttcgtt
tcgcccagccaggaaatccatgcccgattcagaagaggagccagatcttaccaagtgatc
tgcagagatgaaaaaacgcagatgatataccagcaacatcagtcatggctgcgccctgtg
ctcagaagcaaccgggtggaatattgctggtgcaacagtggcagggcacagtgccactca
gtgcctgtcaaaagttgcagcgagccaaggtgtttcaacgggggcacctgccagcaggcc
ctgtacttctcagatttcgtgtgccagtgccccgaaggatttgctgggaagtgctgtgaa
atagataccagggccacgtgctacgaggaccagggcatcagctacaggggcacgtggagc
acagcggagagtggcgccgagtgcaccaactggaacagcagcgcgttggcccagaagccc
tacagcgggcggaggccagacgccatcaggctgggcctggggaaccacaactactgcaga
aacccagatcgagactcaaagccctggtgctacgtctttaaggcggggaagtacagctca
gagttctgcagcacccctgcctgctctgagggaaacagtgactgctactttgggaatggg
tcagcctaccgtggcacgcacagcctcaccgagtcgggtgcctcctgcctcccgtggaat
tccatgatcctgataggcaaggtttacacagcacagaaccccagtgcccaggcactgggc
ctgggcaaacataattactgccggaatcctgatggggatgccaagccctggtgccacgtg
ctgaagaaccgcaggctgacgtgggagtactgtgatgtgccctcctgctccacctgcggc
ctgagacagtacagccagcctcagtttcgcatcaaaggagggctcttcgccgacatcgcc
tcccacccctggcaggctgccatctttgccaagcacaggaggtcgcccggagagcggttc
ctgtgcgggggcatactcatcagctcctgctggattctctctgccgcccactgcttccag
gagaggtttccgccccaccacctgacggtgatcttgggcagaacataccgggtggtccct
ggcgaggaggagcagaaatttgaagtcgaaaaatacattgtccataaggaattcgatgat
gacacttacgacaatgacattgcgctgctgcagctgaaatcggattcgtcccgctgtgcc
caggagagcagcgtggtccgcactgtgtgccttcccccggcggacctgcagctgccggac
tggacggagtgtgagctctccggctacggcaagcatgaggccttgtctcctttctattcg
gagcggctgaaggaggctcatgtcagactgtacccatccagccgctgcacatcacaacat
ttacttaacagaacagtcaccgacaacatgctgtgtgctggagacactcggagcggcggg
ccccaggcaaacttgcacgacgcctgccagggcgattcgggaggccccctggtgtgtctg
aacgatggccgcatgactttggtgggcatcatcagctggggcctgggctgtggacagaag
gatgtcccgggtgtgtacaccaaggttaccaactacctagactggattcgtgacaacatg
cgaccgtga

KEGG   Homo sapiens (human): 4314Help
Entry
4314              CDS       T01001                                 

Gene name
MMP3, CHDS6, MMP-3, SL-1, STMY, STMY1, STR1
Definition
(RefSeq) matrix metallopeptidase 3
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
hsa05323  Rheumatoid arthritis
Network
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00128  TMPRSS2-ERG fusion to transcriptional activation
Disease
H01742  Coronary artery disease
Drug target
Marimastat: D03795
Prinomastat: D03797
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    4314 (MMP3)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    4314 (MMP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4314 (MMP3)
  09162 Cancer: specific types
   05215 Prostate cancer
    4314 (MMP3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    4314 (MMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    4314 (MMP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     4314 (MMP3)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4314 (MMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_4 DUF4953 Reprolysin_3 Reprolysin_5 Reprolysin_2
Motif
Other DBs
NCBI-GeneID: 4314
NCBI-ProteinID: NP_002413
OMIM: 185250
HGNC: 7173
Ensembl: ENSG00000149968
Vega: OTTHUMG00000048254
Pharos: P08254(Tchem)
UniProt: P08254
LinkDB All DBs
Structure
PDB: 

Position
11q22.2
AA seq 477 aa AA seqDB search
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtcttccaatcctactgttgctgtgcgtggcagtttgctcagcctatccattg
gatggagctgcaaggggtgaggacaccagcatgaaccttgttcagaaatatctagaaaac
tactacgacctcaaaaaagatgtgaaacagtttgttaggagaaaggacagtggtcctgtt
gttaaaaaaatccgagaaatgcagaagttccttggattggaggtgacggggaagctggac
tccgacactctggaggtgatgcgcaagcccaggtgtggagttcctgatgttggtcacttc
agaacctttcctggcatcccgaagtggaggaaaacccaccttacatacaggattgtgaat
tatacaccagatttgccaaaagatgctgttgattctgctgttgagaaagctctgaaagtc
tgggaagaggtgactccactcacattctccaggctgtatgaaggagaggctgatataatg
atctcttttgcagttagagaacatggagacttttacccttttgatggacctggaaatgtt
ttggcccatgcctatgcccctgggccagggattaatggagatgcccactttgatgatgat
gaacaatggacaaaggatacaacagggaccaatttatttctcgttgctgctcatgaaatt
ggccactccctgggtctctttcactcagccaacactgaagctttgatgtacccactctat
cactcactcacagacctgactcggttccgcctgtctcaagatgatataaatggcattcag
tccctctatggacctccccctgactcccctgagacccccctggtacccacggaacctgtc
cctccagaacctgggacgccagccaactgtgatcctgctttgtcctttgatgctgtcagc
actctgaggggagaaatcctgatctttaaagacaggcacttttggcgcaaatccctcagg
aagcttgaacctgaattgcatttgatctcttcattttggccatctcttccttcaggcgtg
gatgccgcatatgaagttactagcaaggacctcgttttcatttttaaaggaaatcaattc
tgggctatcagaggaaatgaggtacgagctggatacccaagaggcatccacaccctaggt
ttccctccaaccgtgaggaaaatcgatgcagccatttctgataaggaaaagaacaaaaca
tatttctttgtagaggacaaatactggagatttgatgagaagagaaattccatggagcca
ggctttcccaagcaaatagctgaagactttccagggattgactcaaagattgatgctgtt
tttgaagaatttgggttcttttatttctttactggatcttcacagttggagtttgaccca
aatgcaaagaaagtgacacacactttgaagagtaacagctggcttaattgttga

KEGG   Homo sapiens (human): 4318Help
Entry
4318              CDS       T01001                                 

Gene name
MMP9, CLG4B, GELB, MANDP2, MMP-9
Definition
(RefSeq) matrix metallopeptidase 9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04915  Estrogen signaling pathway
hsa04926  Relaxin signaling pathway
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
hsa05219  Bladder cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (virus)
nt06162  Hepatitis B virus (HBV)
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00128  TMPRSS2-ERG fusion to transcriptional activation
N00130  TMPRSS2-ETV5 fusion to transcriptional activation
N00545  HBV HBx to ERK signaling pathway
Disease
H00025  Penile cancer
H00479  Metaphyseal dysplasias
Drug target
Andecaliximab: D11262
Batimastat: D03061
Cipemastat: D03517
Ilomastat: D03793
Marimastat: D03795
Prinomastat: D03797
Rebimastat: D03800
Tanomastat: D03802
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    4318 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    4318 (MMP9)
   04670 Leukocyte transendothelial migration
    4318 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    4318 (MMP9)
   04926 Relaxin signaling pathway
    4318 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4318 (MMP9)
   05202 Transcriptional misregulation in cancer
    4318 (MMP9)
   05206 MicroRNAs in cancer
    4318 (MMP9)
   05205 Proteoglycans in cancer
    4318 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    4318 (MMP9)
   05215 Prostate cancer
    4318 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4318 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    4318 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    4318 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    4318 (MMP9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     4318 (MMP9)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4318 (MMP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_4 Reprolysin_3 DUF4953 Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 4318
NCBI-ProteinID: NP_004985
OMIM: 120361
HGNC: 7176
Ensembl: ENSG00000100985
Vega: OTTHUMG00000033044
Pharos: P14780(Tchem)
UniProt: P14780
LinkDB All DBs
Structure
PDB: 

Position
20q13.12
AA seq 707 aa AA seqDB search
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgagcctctggcagcccctggtcctggtgctcctggtgctgggctgctgctttgctgcc
cccagacagcgccagtccacccttgtgctcttccctggagacctgagaaccaatctcacc
gacaggcagctggcagaggaatacctgtaccgctatggttacactcgggtggcagagatg
cgtggagagtcgaaatctctggggcctgcgctgctgcttctccagaagcaactgtccctg
cccgagaccggtgagctggatagcgccacgctgaaggccatgcgaaccccacggtgcggg
gtcccagacctgggcagattccaaacctttgagggcgacctcaagtggcaccaccacaac
atcacctattggatccaaaactactcggaagacttgccgcgggcggtgattgacgacgcc
tttgcccgcgccttcgcactgtggagcgcggtgacgccgctcaccttcactcgcgtgtac
agccgggacgcagacatcgtcatccagtttggtgtcgcggagcacggagacgggtatccc
ttcgacgggaaggacgggctcctggcacacgcctttcctcctggccccggcattcaggga
gacgcccatttcgacgatgacgagttgtggtccctgggcaagggcgtcgtggttccaact
cggtttggaaacgcagatggcgcggcctgccacttccccttcatcttcgagggccgctcc
tactctgcctgcaccaccgacggtcgctccgacggcttgccctggtgcagtaccacggcc
aactacgacaccgacgaccggtttggcttctgccccagcgagagactctacacccaggac
ggcaatgctgatgggaaaccctgccagtttccattcatcttccaaggccaatcctactcc
gcctgcaccacggacggtcgctccgacggctaccgctggtgcgccaccaccgccaactac
gaccgggacaagctcttcggcttctgcccgacccgagctgactcgacggtgatggggggc
aactcggcgggggagctgtgcgtcttccccttcactttcctgggtaaggagtactcgacc
tgtaccagcgagggccgcggagatgggcgcctctggtgcgctaccacctcgaactttgac
agcgacaagaagtggggcttctgcccggaccaaggatacagtttgttcctcgtggcggcg
catgagttcggccacgcgctgggcttagatcattcctcagtgccggaggcgctcatgtac
cctatgtaccgcttcactgaggggccccccttgcataaggacgacgtgaatggcatccgg
cacctctatggtcctcgccctgaacctgagccacggcctccaaccaccaccacaccgcag
cccacggctcccccgacggtctgccccaccggaccccccactgtccacccctcagagcgc
cccacagctggccccacaggtcccccctcagctggccccacaggtccccccactgctggc
ccttctacggccactactgtgcctttgagtccggtggacgatgcctgcaacgtgaacatc
ttcgacgccatcgcggagattgggaaccagctgtatttgttcaaggatgggaagtactgg
cgattctctgagggcagggggagccggccgcagggccccttccttatcgccgacaagtgg
cccgcgctgccccgcaagctggactcggtctttgaggagcggctctccaagaagcttttc
ttcttctctgggcgccaggtgtgggtgtacacaggcgcgtcggtgctgggcccgaggcgt
ctggacaagctgggcctgggagccgacgtggcccaggtgaccggggccctccggagtggc
agggggaagatgctgctgttcagcgggcggcgcctctggaggttcgacgtgaaggcgcag
atggtggatccccggagcgccagcgaggtggaccggatgttccccggggtgcctttggac
acgcacgacgtcttccagtaccgagagaaagcctatttctgccaggaccgcttctactgg
cgcgtgagttcccggagtgagttgaaccaggtggaccaagtgggctacgtgacctatgac
atcctgcagtgccctgaggactag

KEGG   Homo sapiens (human): 6935Help
Entry
6935              CDS       T01001                                 

Gene name
ZEB1, AREB6, BZP, DELTAEF1, FECD6, NIL2A, PPCD3, TCF8, ZFHEP, ZFHX1A
Definition
(RefSeq) zinc finger E-box binding homeobox 1
  KO
K09299  zinc finger homeobox protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
Network
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00128  TMPRSS2-ERG fusion to transcriptional activation
Disease
H00960  Fuchs corneal dystrophy
H00961  Posterior polymorphous corneal dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    6935 (ZEB1)
   05206 MicroRNAs in cancer
    6935 (ZEB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    6935 (ZEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6935 (ZEB1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, AbdB
    6935 (ZEB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-Di19 zf-C2H2_jaz Homeodomain zf-C2H2_6 zf-H2C2_5 zf-C2H2_2
Motif
Other DBs
NCBI-GeneID: 6935
NCBI-ProteinID: NP_110378
OMIM: 189909
HGNC: 11642
Ensembl: ENSG00000148516
Vega: OTTHUMG00000017907
Pharos: P37275(Tbio)
UniProt: P37275 B2RBI8
LinkDB All DBs
Structure
PDB: 

Position
10p11.22
AA seq 1124 aa AA seqDB search
MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDD
LPTDQTVLPGRSSEREGNAKNCWEDDRKEGQEILGPEAQADEAGCTVKDDECESDAENEQ
NHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYK
RFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKF
KCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNG
RPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIVV
ASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVAV
DGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLE
QPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGD
INALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYY
ALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNND
QPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYL
YTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKD
SCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQ
VAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
NGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPY
QCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQG
DSDERESLTREEDEDSEKEEEEEDKEMEELQEEKECEKPQGDEEEEEEEEEVEEEEVEEA
ENEGEEAKTEGLMKDDRAESQASSLGQKVGESSEQVSEEKTNEA
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atggcggatggccccaggtgtaagcgcagaaagcaggcgaacccgcggcgcaataacgtt
acaaattataatactgtggtagaaacaaattcagattcagatgatgaagacaaactgcat
attgtggaagaagaaagtgttacagatgcagctgactgtgaaggtgtaccagaggatgac
ctgccaacagaccagacagtgttaccagggaggagcagtgaaagagaagggaatgctaag
aactgctgggaggatgacagaaaggaagggcaagaaatcctggggcctgaagctcaggca
gatgaagcaggatgtacagtaaaagatgatgaatgcgagtcagatgcagaaaatgagcaa
aaccatgatcctaatgttgaagagtttctacaacaacaagacactgctgtcatttttcct
gaggcacctgaagaggaccagaggcagggcacaccagaagccagtggtcatgatgaaaat
ggaacaccagatgcattttcacaattactcacctgtccatattgtgatagaggctataaa
cgctttacctctctgaaagaacacattaaatatcgtcatgaaaagaatgaagataacttt
agttgctccctgtgcagttacacctttgcatacagaacccaacttgaacgtcacatgaca
tcacataaatcaggaagagatcaaagacatgtgacgcagtctgggtgtaatcgtaaattc
aaatgcactgagtgtggaaaagctttcaaatacaaacatcacctaaaagagcacttaaga
attcacagtggagagaagccatatgaatgcccaaactgcaagaaacgcttttcccattct
ggctcctatagctcacacataagcagtaagaaatgtatcagcttgatacctgtgaatggg
cgaccaagaacaggactcaagacatctcagtgttcttcaccgtctctttcagcatcacca
ggcagtcccacacgaccacagatacggcaaaagatagagaataaaccccttcaagaacaa
ctttctgttaaccaaattaaaactgaacctgtggattatgaattcaaacccatagtggtt
gcttcaggaatcaactgttcaacccctttacaaaatggggttttcactggtggtggccca
ttacaggcaaccagttctcctcagggcatggtgcaagctgttgttctgccaacagttggt
ttggtgtctcccataagtatcaatttaagtgatattcagaatgtacttaaagtggcggta
gatggtaatgtaataaggcaagtgttggagaataatcaagccaatcttgcatccaaagaa
caagaaacaatcaatgcttcacccatacaacaaggtggccattctgttatttcagccatc
agtcttcctttggttgatcaagatggaacaaccaaaattatcatcaactacagtcttgag
cagcctagccaacttcaagttgttcctcaaaatttaaaaaaagaaaatccagtcgctaca
aacagttgtaaaagtgaaaagttaccagaagatcttactgttaagtctgagaaggacaaa
agctttgaagggggggtgaatgatagcacttgtcttctgtgtgatgattgtccaggagat
attaatgcacttccagaattaaagcactatgacctaaagcagcctactcagcctcctcca
ctccctgcagcagaagctgagaagcctgagtcctctgtttcatcagctactggagatggc
aatttgtctcctagtcagccacctttaaagaacctcttgtctctcctaaaagcatattat
gctttgaatgcacaaccaagtgcagaagagctctcaaaaattgctgattcagtaaaccta
ccactggatgtagtaaaaaagtggtttgaaaagatgcaagctggacagatttcagtgcag
tcttctgaaccatcttctcctgaaccaggcaaagtaaatatccctgccaagaacaatgat
cagcctcaatctgcaaatgcaaatgaaccccaggacagcacagtaaatctacaaagtcct
ttgaagatgactaactccccagttttaccagtgggatcaaccaccaatggttccagaagt
agtacaccatccccatcacctctaaacctttcctcatccagaaatacacagggttacttg
tacacagctgagggtgcacaagaagagccacaagtagaacctcttgatctttcactacca
aagcaacagggagaattattagaaaggtcaactatcactagtgtttaccagaacagtgtt
tattctgtccaggaagaacccttgaacttgtcttgcgcaaaaaaggagccacaaaaggac
agttgtgttacagactcagaaccagttgtaaatgtaatcccaccaagtgccaaccccata
aatatcgctatacctacagtcactgcccagttacccacaatcgtggccattgctgaccag
aacagtgttccatgcttaagagcgctagctgccaataagcaaacgattctgattccccag
gtggcatacacctactcaactacggtcagccctgcagtccaagaaccacccttgaaagtg
atccagccaaatggaaatcaggatgaaagacaagatactagctcagaaggagtatcaaat
gtagaggatcagaatgactctgattctacaccgcccaaaaagaaaatgcggaagacagaa
aatggaatgtatgcttgtgatttgtgtgacaagatattccaaaagagtagttcattattg
agacataaatatgaacacacaggtaaaagacctcatgagtgtggaatctgtaaaaaggca
tttaaacacaaacatcatttgattgaacacatgcgattacattctggagaaaagccctat
caatgtgacaaatgtggaaagcgcttctcacactctgggtcttattctcaacacatgaat
catcgctactcctactgtaagagagaagcggaagaacgtgacagcacagagcaggaagag
gcagggcctgaaatcctctcgaatgagcacgtgggtgccagggcgtctccctcacagggc
gactcggacgagagagagagtttgacaagggaagaggatgaagacagtgaaaaagaggaa
gaggaggaggataaagagatggaagaattgcaggaagaaaaagaatgtgaaaaaccacaa
ggggatgaggaagaggaggaggaggaggaagaagtggaagaagaagaggtagaagaggca
gagaatgagggagaagaagcaaaaactgaaggtctgatgaaggatgacagggctgaaagt
caagcaagcagcttaggacaaaaagtaggcgagagtagtgagcaagtgtctgaagaaaag
acaaatgaagcctaa

KEGG   Homo sapiens (human): 7850Help
Entry
7850              CDS       T01001                                 

Gene name
IL1R2, CD121b, CDw121b, IL-1R-2, IL-1RT-2, IL-1RT2, IL1R2c, IL1RB
Definition
(RefSeq) interleukin 1 receptor type 2
  KO
K04387  interleukin 1 receptor type II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04640  Hematopoietic cell lineage
hsa05146  Amoebiasis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00128  TMPRSS2-ERG fusion to transcriptional activation
Drug target
Anakinra: D02934
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7850 (IL1R2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    7850 (IL1R2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    7850 (IL1R2)
  09162 Cancer: specific types
   05215 Prostate cancer
    7850 (IL1R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    7850 (IL1R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7850 (IL1R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    7850 (IL1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    7850 (IL1R2)
   04090 CD molecules [BR:hsa04090]
    7850 (IL1R2)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   7850 (IL1R2)
CD molecules [BR:hsa04090]
 Proteins
  7850 (IL1R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 Ig_2 I-set Ig_6 V-set Izumo-Ig Ig_5 stn_TNFRSF12A
Motif
Other DBs
NCBI-GeneID: 7850
NCBI-ProteinID: NP_004624
OMIM: 147811
HGNC: 5994
Ensembl: ENSG00000115590
Vega: OTTHUMG00000130695
Pharos: P27930(Tbio)
UniProt: P27930
LinkDB All DBs
Structure
PDB: 

Position
2q11.2
AA seq 398 aa AA seqDB search
MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
IELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN
EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSWGIVLAPLSLA
FLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcttgtacgtgttggtaatgggagtttctgccttcacccttcagcctgcggca
cacacaggggctgccagaagctgccggtttcgtgggaggcattacaagcgggagttcagg
ctggaaggggagcctgtagccctgaggtgcccccaggtgccctactggttgtgggcctct
gtcagcccccgcatcaacctgacatggcataaaaatgactctgctaggacggtcccagga
gaagaagagacacggatgtgggcccaggacggtgctctgtggcttctgccagccttgcag
gaggactctggcacctacgtctgcactactagaaatgcttcttactgtgacaaaatgtcc
attgagctcagagtttttgagaatacagatgctttcctgccgttcatctcatacccgcaa
attttaaccttgtcaacctctggggtattagtatgccctgacctgagtgaattcacccgt
gacaaaactgacgtgaagattcaatggtacaaggattctcttcttttggataaagacaat
gagaaatttctaagtgtgagggggaccactcacttactcgtacacgatgtggccctggaa
gatgctggctattaccgctgtgtcctgacatttgcccatgaaggccagcaatacaacatc
actaggagtattgagctacgcatcaagaaaaaaaaagaagagaccattcctgtgatcatt
tcccccctcaagaccatatcagcttctctggggtcaagactgacaatcccgtgtaaggtg
tttctgggaaccggcacacccttaaccaccatgctgtggtggacggccaatgacacccac
atagagagcgcctacccgggaggccgcgtgaccgaggggccacgccaggaatattcagaa
aataatgagaactacattgaagtgccattgatttttgatcctgtcacaagagaggatttg
cacatggattttaaatgtgttgtccataataccctgagttttcagacactacgcaccaca
gtcaaggaagcctcctccacgttctcctggggcattgtgctggccccactttcactggcc
ttcttggttttggggggaatatggatgcacagacggtgcaaacacagaactggaaaagca
gatggtctgactgtgctatggcctcatcatcaagactttcaatcctatcccaagtga

DBGET integrated database retrieval system