KEGG   Homo sapiens (human): 53342Help
Entry
53342             CDS       T01001                                 

Gene name
IL17D, IL-17D
Definition
(RefSeq) interleukin 17D
  KO
K05492  interleukin 17D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    53342 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    53342 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    53342 (IL17D)
   04659 Th17 cell differentiation
    53342 (IL17D)
   04657 IL-17 signaling pathway
    53342 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    53342 (IL17D)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   53342 (IL17D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL17
Motif
Other DBs
NCBI-GeneID: 53342
NCBI-ProteinID: NP_612141
OMIM: 607587
HGNC: 5984
Ensembl: ENSG00000172458
Vega: OTTHUMG00000016521
Pharos: Q8TAD2(Tbio)
UniProt: Q8TAD2
LinkDB All DBs
Position
13q12.11
AA seq 202 aa AA seqDB search
MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQL
GPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCL
TGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSI
NSSIDKQGAKLLLGPNDAPAGP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgctggtagccggcttcctgctggcgctgccgccgagctgggccgcgggcgccccgagg
gcgggcaggcgccccgcgcggccgcggggctgcgcggaccggccggaggagctactggag
cagctgtacgggcgcctggcggccggcgtgctcagtgccttccaccacacgctgcagctg
gggccgcgtgagcaggcgcgcaacgcgagctgcccggcagggggcaggcccgccgaccgc
cgcttccggccgcccaccaacctgcgcagcgtgtcgccctgggcctacagaatctcctac
gacccggcgaggtaccccaggtacctgcctgaagcctactgcctgtgccggggctgcctg
accgggctgttcggcgaggaggacgtgcgcttccgcagcgcccctgtctacatgcccacc
gtcgtcctgcgccgcacccccgcctgcgccggcggccgttccgtctacaccgaggcctac
gtcaccatccccgtgggctgcacctgcgtccccgagccggagaaggacgcagacagcatc
aactccagcatcgacaaacagggcgccaagctcctgctgggccccaacgacgcgcccgct
ggcccctga

DBGET integrated database retrieval system