KEGG   Homo sapiens (human): 53349
Entry
53349             CDS       T01001                                 

Gene name
ZFYVE1, DFCP1, PPP1R172, SR3, TAFF1, ZNFN2A1
Definition
(RefSeq) zinc finger FYVE-type containing 1
  KO
K17603  zinc finger FYVE domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
  Element
N00155  Autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    53349 (ZFYVE1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    53349 (ZFYVE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    53349 (ZFYVE1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    53349 (ZFYVE1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    53349 (ZFYVE1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     53349 (ZFYVE1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    53349 (ZFYVE1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    53349 (ZFYVE1)
SSDB
Motif
Pfam: FYVE zf-B_box GBP AIG1 Eapp_C DUF429
Other DBs
NCBI-GeneID: 53349
NCBI-ProteinID: NP_067083
OMIM: 605471
HGNC: 13180
Ensembl: ENSG00000165861
Vega: OTTHUMG00000171365
Pharos: Q9HBF4(Tbio)
UniProt: Q9HBF4
LinkDB
Position
14q24.2
AA seq 777 aa
MSAQTSPAEKGLNPGLMCQESYACSGTDEAIFECDECCSLQCLRCEEELHRQERLRNHER
IRLKPGHVPYCDLCKGLSGHLPGVRQRAIVRCQTCKINLCLECQKRTHSGGNKRRHPVTV
YNVSNLQESLEAEEMDEETKRKKMTEKVVSFLLVDENEEIQVTNEEDFIRKLDCKPDQHL
KVVSIFGNTGDGKSHTLNHTFFYGREVFKTSPTQESCTVGVWAAYDPVHKVAVIDTEGLL
GATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASEAYLKHFTKELKATTA
RCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEVPEKLIQDRFRKLGRFPEAFSSIHYK
GTRTYNPPTDFSGLRRALEQLLENNTTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHSS
FFPDEYFTCSSLCLSCGVGCKKSMNHGKEGVPHEAKSRCRYSHQYDNRVYTCKACYERGE
EVSVVPKTSASTDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIV
HVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQ
ILSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCYEARNV
QLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILH
CHNCRKEFSIKLSKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNCNKKPGDL
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgagtgcccagacttccccagcagagaagggcctgaatccggggctgatgtgccaggaa
agttacgcttgcagcgggactgatgaagctatctttgagtgtgatgagtgctgcagtctg
cagtgtctccgctgcgaggaggagctccatcggcaggagcgcctgagaaaccatgagcgg
ataagactcaaacctggccatgtcccttactgtgacctctgcaagggtctcagtgggcat
ttaccaggtgttaggcagagggcaatagtgaggtgccagacctgcaaaattaacttgtgc
ctggagtgccagaagaggactcattctgggggtaacaaaaggagacaccctgttactgtg
tacaatgtcagtaatctccaggagtcactggaggcagaagagatggatgaggagaccaag
aggaagaagatgactgagaaggttgtgagtttcctcctagtagacgaaaatgaagaaatt
caggtaacaaatgaagaagactttattagaaaattggactgcaaacctgatcagcatctg
aaagtggtttccatttttggaaatactggtgatggaaagtctcatactctcaaccacact
ttcttttatggtcgtgaagtctttaaaacctccccgacccaggagtcctgcactgtggga
gtgtgggcagcctatgacccagttcacaaagtagcagtgatcgatacggaagggctcctg
ggggccaccgtgaatctaagccagagaacacggctgctgcttaaggtcctggccatctca
gacctcgtcatctatcgaactcatgcagaccggctgcataacgacctcttcaaattcctt
ggggatgcctcagaagcttatctgaagcacttcaccaaggagctcaaggccaccactgct
cgctgtggcctggatgtccctttatccacactgggccctgcagttatcatcttccatgag
accgtgcacacccagctactgggctctgatcatccctcagaggtgccagagaagctcatc
caggaccggttccggaagctgggccgtttccctgaagcctttagttccattcactacaag
ggaacgaggacttacaaccctcccacggacttttctgggcttcggcgtgctttggagcag
ctactagagaataacaccacccgttctccccggcacccgggagtcatcttcaaagccctg
aaggcactaagtgaccgcttcagcggtgagatccccgatgaccagatggcgcacagctcc
ttttttccagatgagtatttcacctgctcctccttgtgcctcagctgtggggttggatgt
aagaaaagcatgaatcatgggaaggaaggagtgcctcatgaagccaagagccgctgcaga
tactcccaccagtatgacaaccgagtgtatacctgcaaggcctgctatgagagaggcgag
gaagtcagtgtagtgcccaaaacatctgcttccactgactccccctggatgggtctcgca
aaatatgcctggtctgggtatgtgatcgaatgtcctaactgtggcgtggtctatcgtagt
cggcagtactggtttggaaaccaagatcctgtggatacggtggtgcggacagagattgtg
catgtgtggcctggaactgatgggtttctgaaggacaacaacaatgctgcccagcgcctg
ttggacgggatgaacttcatggctcagtcggtgtccgagcttagccttggacccaccaag
gctgtgacttcctggctgacagaccagatcgcccctgcctactggaggcccaactcccag
attctgagctgcaacaagtgtgcgacgtcctttaaagataacgacactaagcatcactgc
cgagcctgtggggagggcttctgtgacagctgttcatcaaagactcggccagtgcctgag
cggggctggggccctgcgccagtgcgggtctgtgacaactgctacgaagccaggaacgtc
cagttagctgttaccgaggcacaagtggacgatgaaggtggaacgctcattgctcggaag
gtgggcgaggccgtgcagaacactctgggagccgtggtgacagccattgacataccacta
ggtctggtaaaggacgcggccaggcctgcgtactgggtgcctgaccacgaaatcctccac
tgccacaactgccggaaggagttcagcatcaagctctccaagcaccactgccgggcctgc
ggacagggcttctgtgatgagtgctcccatgaccgccgggctgttccttctcgtggctgg
gaccatcccgtccgagtctgcttcaactgcaataaaaagcccggtgacctttaa

DBGET integrated database retrieval system