KEGG   Homo sapiens (human): 5337Help
Entry
5337              CDS       T01001                                 

Gene name
PLD1, CVDD
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04912  GnRH signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05200  Pathways in cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5337 (PLD1)
   00565 Ether lipid metabolism
    5337 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5337 (PLD1)
   04072 Phospholipase D signaling pathway
    5337 (PLD1)
   04071 Sphingolipid signaling pathway
    5337 (PLD1)
   04024 cAMP signaling pathway
    5337 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5337 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    5337 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5337 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    5337 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    5337 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5337 (PLD1)
   05231 Choline metabolism in cancer
    5337 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    5337 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5337 (PLD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     5337 (PLD1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5337 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    5337 (PLD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX PLDc_2 PLDc PH
Motif
Other DBs
NCBI-GeneID: 5337
NCBI-ProteinID: NP_002653
OMIM: 602382
HGNC: 9067
Ensembl: ENSG00000075651
Vega: OTTHUMG00000156947
Pharos: Q13393(Tchem)
UniProt: Q13393 Q59EA4
LinkDB All DBs
Position
3q26.31
AA seq 1074 aa AA seqDB search
MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSA
IYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRR
KQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGIRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENALAKWYVNAKG
YFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLPPAAMESMESLRLKDKNEPVQNLPIQKS
IDDVDSKLKGIGKPRKFSKFSLYKQLHRHHLHDADSISSIDSTSSYFNHYRSHHNLIHGL
KPHFKLFHPSSESEQGLTRPHADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVIENSRHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARGLRLQCF
RVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFI
NKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgaaaaacgagccacgggtaaatacctctgcactgcagaaaattgctgctgac
atgagtaatatcatagaaaatctggacacgcgggaactccactttgagggagaggaggta
gactacgacgtgtctcccagcgatcccaagatacaagaagtgtatatccctttctctgct
atttataacactcaaggatttaaggagcctaatatacagacgtatctctccggctgtcca
ataaaagcacaagttctggaagtggaacgcttcacatctacaacaagggtaccaagtatt
aatctttacactattgaattaacacatggggaatttaaatggcaagttaagaggaaattc
aagcattttcaagaatttcacagagagctgctcaagtacaaagcctttatccgcatcccc
attcccactagaagacacacgtttaggaggcaaaacgtcagagaggagcctcgagagatg
cccagtttgccccgttcatctgaaaacatgataagagaagaacaattccttggtagaaga
aaacaactggaagattacttgacaaagatactaaaaatgcccatgtatagaaactatcat
gccacaacagagtttcttgatataagccagctgtctttcatccatgatttgggaccaaag
ggcatagaaggtatgataatgaaaagatctggaggacacagaataccaggcttgaattgc
tgtggtcagggaagagcctgctacagatggtcaaaaagatggttaatagtgaaagattcc
tttttattgtatatgaaaccagacagcggtgccattgccttcgtcctgctggtagacaaa
gaattcaaaattaaggtggggaagaaggagacagaaacgaaatatggaatccgaattgat
aatctttcaaggacacttattttaaaatgcaacagctatagacatgctcggtggtgggga
ggggctatagaagaattcatccagaaacatggcaccaactttctcaaagatcatcgattt
gggtcatatgctgctatccaagagaatgctttagctaaatggtatgttaatgccaaagga
tattttgaagatgtggcaaatgcaatggaagaggcaaatgaagagatttttatcacagac
tggtggctgagtccagaaatcttcctgaaacgcccagtggttgagggaaatcgttggagg
ttggactgcattcttaaacgaaaagcacaacaaggagtgaggatcttcataatgctctac
aaagaggtggaactcgctcttggcatcaatagtgaatacaccaagaggactttgatgcgt
ctacatcccaacataaaggtgatgagacacccggatcatgtgtcatccaccgtctatttg
tgggctcaccatgagaagcttgtcatcattgaccaatcggtggcctttgtgggagggatt
gacctggcctatggaaggtgggacgacaatgagcacagactcacagacgtgggcagtgtg
aagcgggtcacttcaggaccgtctctgggttccctcccacctgccgcaatggagtctatg
gaatccttaagactcaaagataaaaatgagcctgttcaaaacctacccatccagaagagt
attgatgatgtggattcaaaactgaaaggaataggaaagccaagaaagttctccaaattt
agtctctacaagcagctccacaggcaccacctgcacgacgcagatagcatcagcagcatt
gacagcacctccagttattttaatcactatagaagtcatcacaatttaatccatggttta
aaaccccacttcaaactctttcacccgtccagtgagtctgagcaaggactcactagacct
catgctgataccgggtccatccgtagtttacagacaggtgtgggagagctgcatggggaa
accagattctggcatggaaaggactactgcaatttcgtcttcaaagactgggttcaactt
gataaaccttttgctgatttcattgacaggtactccacgccccggatgccctggcatgac
attgcctctgcagtccacgggaaggcggctcgtgatgtggcacgtcacttcatccagcgc
tggaacttcacaaaaattatgaaatcaaaatatcggtccctttcttatccttttctgctt
ccaaagtctcaaacaacagcccatgagttgagatatcaagtgcctgggtctgtccatgct
aacgtacagttgctccgctctgctgctgattggtctgctggtataaagtaccatgaagag
tccatccacgccgcttacgtccatgtgatagagaacagcaggcactatatctatatcgaa
aaccagtttttcataagctgtgctgatgacaaagttgtgttcaacaagataggcgatgcc
attgcccagaggatcctgaaagctcacagggaaaaccagaaataccgggtatatgtcgtg
ataccacttctgccagggttcgaaggagacatttcaaccggcggaggaaatgctctacag
gcaatcatgcacttcaactacagaaccatgtgcagaggagaaaattccatccttggacag
ttaaaagcagagcttggtaatcagtggataaattacatatcattctgtggtcttagaaca
catgcagagctcgaaggaaacctagtaactgagcttatctatgtccacagcaagttgtta
attgctgatgataacactgttattattggctctgccaacataaatgaccgcagcatgctg
ggaaagcgtgacagtgaaatggctgtcattgtgcaagatacagagactgttccttcagta
atggatggaaaagagtaccaagctggccggtttgcccgaggacttcggctacagtgcttt
agggttgtccttggctatcttgatgacccaagtgaggacattcaggatccagtgagtgac
aaattcttcaaggaggtgtgggtttcaacagcagctcgaaatgctacaatttatgacaag
gttttccggtgccttcccaatgatgaagtacacaatttaattcagctgagagactttata
aacaagcccgtattagctaaggaagatcccattcgagctgaggaggaactgaagaagatc
cgtggatttttggtgcaattccccttttatttcttgtctgaagaaagcctactgccttct
gttgggaccaaagaggccatagtgcccatggaggtttggacttaa

DBGET integrated database retrieval system