KEGG   Homo sapiens (human): 5350Help
Entry
5350              CDS       T01001                                 

Gene name
PLN, CMD1P, CMH18, PLB
Definition
(RefSeq) phospholamban
  KO
K05852  phospholamban
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04919  Thyroid hormone signaling pathway
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00294  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5350 (PLN)
   04024 cAMP signaling pathway
    5350 (PLN)
   04022 cGMP - PKG signaling pathway
    5350 (PLN)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    5350 (PLN)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5350 (PLN)
 Human Diseases
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    5350 (PLN)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   5350 (PLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholamban Sarcolipin DUF5383 DUF1510
Motif
Other DBs
NCBI-GeneID: 5350
NCBI-ProteinID: NP_002658
OMIM: 172405
HGNC: 9080
Ensembl: ENSG00000198523
Vega: OTTHUMG00000015462
Pharos: P26678(Tbio)
UniProt: P26678 Q5R352
LinkDB All DBs
Structure
PDB: 

Position
6q22.31
AA seq 52 aa AA seqDB search
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
NT seq 159 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagtccaatacctcactcgctcagctataagaagagcctcaaccattgaaatg
cctcaacaagcacgtcaaaagctacagaatctatttatcaatttctgtctcatcttaata
tgtctcttgctgatctgtatcatcgtgatgcttctctga

DBGET integrated database retrieval system