KEGG   Homo sapiens (human): 5358
Entry
5358              CDS       T01001                                 

Gene name
PLS3, BMND18, T-plastin
Definition
(RefSeq) plastin 3
  KO
K17336  plastin-3
Organism
hsa  Homo sapiens (human)
Disease
H01593  Osteoporosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5358 (PLS3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    5358 (PLS3)
   04147 Exosome [BR:hsa04147]
    5358 (PLS3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    5358 (PLS3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     5358 (PLS3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5358 (PLS3)
SSDB
Motif
Pfam: CH EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 CAMSAP_CH EF-hand_8 DUF5580
Other DBs
NCBI-GeneID: 5358
NCBI-ProteinID: NP_001129497
OMIM: 300131
HGNC: 9091
Ensembl: ENSG00000102024
Vega: OTTHUMG00000022237
Pharos: P13797(Tbio)
UniProt: P13797
LinkDB
Structure
PDB: 
1AOA 1WJO

Position
Xq23
AA seq 630 aa
MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKL
MLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHS
YSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDE
RAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLF
ADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSK
AYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVS
GNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLY
ADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVG
IGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTS
IQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARV
YALPEDLVEVKPKMVMTVFACLMGRGMKRV
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggatgagatggctaccactcagatttccaaagatgagcttgatgaactcaaagaggcc
tttgcaaaagttgatctcaacagcaacggattcatttgtgactatgaacttcatgagctc
ttcaaggaagctaatatgccattaccaggatataaagtgagagaaattattcagaaactc
atgctggatggtgacaggaataaagatgggaaaataagttttgacgaatttgtttatatt
tttcaagaggtaaaaagtagtgatattgccaagaccttccgcaaagcaatcaacaggaaa
gaaggtatttgtgctctgggtggaacttcagagttgtccagcgaaggaacacagcattct
tactcagaggaagaaaaatatgcttttgttaactggataaacaaagctttggaaaatgat
cctgattgtagacatgttataccaatgaaccctaacaccgatgacctgttcaaagctgtt
ggtgatggaattgtgctttgtaaaatgattaacctttcagttcctgataccattgatgaa
agagcaatcaacaagaagaaacttacacccttcatcattcaggaaaacttgaacttggca
ctgaactctgcttctgccattgggtgtcatgttgtgaacattggtgcagaagatttgagg
gctgggaaacctcatctggttttgggactgctttggcagatcattaagatcggtttgttc
gctgacattgaattaagcaggaatgaagccttggctgctttactccgagatggtgagact
ttggaggaacttatgaaattgtctccagaagagcttctgcttagatgggcaaactttcat
ttggaaaactcgggctggcaaaaaattaacaactttagtgctgacatcaaggattccaaa
gcctatttccatcttctcaatcaaatcgcaccaaaaggacaaaaggaaggtgaaccacgg
atagatattaacatgtcaggtttcaatgaaacagatgatttgaagagagctgagagtatg
cttcaacaagcagataaattaggttgcagacagtttgttacccctgctgatgttgtcagt
ggaaaccccaaactcaacttagctttcgtggctaacctgtttaataaatacccagcacta
actaagccagagaaccaggatattgactggactctattagaaggagaaactcgtgaagaa
agaaccttccgtaactggatgaactctcttggtgtcaatcctcacgtaaaccatctctat
gctgacctgcaagatgccctggtaatcttacagttatatgaacgaattaaagttcctgtt
gactggagtaaggttaataaacctccatacccgaaactgggagccaacatgaaaaagcta
gaaaactgcaactatgctgttgaattagggaagcatcctgctaaattctccctggttggc
attggagggcaagacctgaatgatgggaaccaaaccctgactttagctttagtctggcag
ctgatgagaagatataccctcaatgtcctggaagatcttggagatggtcagaaagccaat
gacgacatcattgtgaactgggtgaacagaacgttgagtgaagctggaaaatcaacttcc
attcagagttttaaggacaagacgatcagctccagtttggcagttgtggatttaattgat
gccatccagccaggctgtataaactatgaccttgtgaagagtggcaatctaacagaagat
gacaagcacaataatgccaagtatgcagtgtcaatggctagaagaatcggagccagagtg
tatgctctccctgaagaccttgtggaagtaaagcccaagatggtcatgactgtgtttgca
tgtttgatgggcaggggaatgaagagagtgtaa

DBGET integrated database retrieval system