KEGG   Homo sapiens (human): 5361Help
Entry
5361              CDS       T01001                                 

Gene name
PLXNA1, NOV, NOVP, PLEXIN-A1, PLXN1
Definition
(RefSeq) plexin A1
  KO
K06820  plexin A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    5361 (PLXNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 TIG_plexin PSI
Motif
Other DBs
NCBI-GeneID: 5361
NCBI-ProteinID: NP_115618
OMIM: 601055
HGNC: 9099
Ensembl: ENSG00000114554
Vega: OTTHUMG00000044222
Pharos: Q9UIW2(Tbio)
UniProt: Q9UIW2
LinkDB All DBs
Position
3q21.3
AA seq 1896 aa AA seqDB search
MPLPPRSLQVLLLLLLLLLLLPGMWAEAGLPRAGGGSQPPFRTFSASDWGLTHLVVHEQT
GEVYVGAVNRIYKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLL
DYAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVQEAGSMAGVLIAGPPGQ
GQAKLFVGTPIDGKSEYFPTLSSRRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFP
AFDIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVRLCVDDPKFYSYVEFPI
GCEQAGVEYRLVQDAYLSRPGRALAHQLGLAEDEDVLFTVFAQGQKNRVKPPKESALCLF
TLRAIKEKIKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDDDFCGQDFNQPLGGTVT
IEGTPLFVDKDDGLTAVAAYDYRGRTVVFAGTRSGRIRKILVDLSNPGGRPALAYESVVA
QEGSPILRDLVLSPNHQYLYAMTEKQVTRVPVESCVQYTSCELCLGSRDPHCGWCVLHSI
CSRRDACERADEPQRFAADLLQCVQLTVQPRNVSVTMSQVPLVLQAWNVPDLSAGVNCSF
EDFTESESVLEDGRIHCRSPSAREVAPITRGQGDQRVVKLYLKSKETGKKFASVDFVFYN
CSVHQSCLSCVNGSFPCHWCKYRHVCTHNVADCAFLEGRVNVSEDCPQILPSTQIYVPVG
VVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDVS
DLPVNLSVVWNGNFVIDNPQNIQAHLYKCPALRESCGLCLKADPRFECGWCVAERRCSLR
HHCAADTPASWMHARHGSSRCTDPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGV
RVGKVLCSPVESEYISAEQIVCEIGDASSVRAHDALVEVCVRDCSPHYRALSPKRFTFVT
PTFYRVSPSRGPLSGGTWIGIEGSHLNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQS
PGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPR
IRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLN
STSFLYYPDPVLEPLSPTGLLELKPSSPLILKGRNLLPPAPGNSRLNYTVLIGSTPCTLT
VSETQLLCEAPNLTGQHKVTVRAGGFEFSPGTLQVYSDSLLTLPAIVGIGGGGGLLLLVI
VAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIP
FLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRS
FSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKM
LTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDY
KTLTLNCVNPENENAPEVPVKGLDCDTVTQAKEKLLDAAYKGVPYSQRPKAADMDLEWRQ
GRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSL
SRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYL
TRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDADVRHTW
KSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKL
LYAKDIPNYKSWVERYYADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYIT
KYKDEILAALEKDEQARRQRLRSKLEQVVDTMALSS
NT seq 5691 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgccaccgcggagcctgcaggtgctcctgctgctgctgctgttgctgctgctg
ctgccgggcatgtgggctgaggcaggcttgcccagggcaggcgggggttcacagcccccc
ttccgcaccttctcggccagcgactggggcctcacccacctagtggtgcatgagcagaca
ggcgaggtgtatgtgggcgcagtgaaccgcatctataagctgtcggggaacctgacactg
ctgcgggcccacgtcacgggccctgtggaggacaacgagaagtgctacccgccgcccagc
gtgcagtcctgcccccacggcctgggcagtactgacaacgtcaacaagctgctgctgctg
gactatgccgctaaccgcctgctggcctgtggcagcgcctcccagggcatctgccagttc
ctgcgtctggacgatctcttcaaactgggtgagccacaccaccgtaaggagcactacctg
tccagcgtgcaggaggcaggcagcatggcgggcgtgctcattgccgggccaccgggccag
ggccaggccaagctcttcgtgggcacacccatcgatggcaagtccgagtacttccccaca
ctgtccagccgtcggctcatggccaacgaggaggatgccgacatgttcggcttcgtgtac
caggatgagtttgtgtcatcacagctcaagatcccttcggacacgctgtccaagttcccg
gcctttgacatctactatgtgtacagcttccgcagcgagcagtttgtctactacctcacg
ctgcagctagacacacagctgacctcgcctgatgccgccggcgagcacttcttcacgtcc
aagatcgtgcggctctgtgtggacgaccccaaattctactcgtacgttgagttccccatt
ggctgcgagcaggcgggtgtggagtaccgcctggtgcaggatgcctacctgagccggccc
ggccgtgccctggcccaccagctgggcctggctgaggacgaggacgtgctgttcactgtg
ttcgcccagggccagaagaaccgcgtgaagccaccaaaggagtcagcactgtgcctgttc
acgctcagggccatcaaggagaagattaaggagcgcatccagtcctgctaccgtggtgag
ggcaagctctccctgccgtggctgctcaacaaggagctgggctgcatcaactcgcccctg
cagatcgatgacgacttctgcgggcaggacttcaaccagcccctggggggcacagtcacc
attgaggggacgcccctgttcgtggacaaggatgatggcctgaccgccgtggctgcctat
gactatcggggccgcactgtggtattcgccggcacgcgaagtggccgcatccgcaagatc
ctggtggacctctcaaaccccggtggccggcctgccctggcctacgagagcgtcgtggcc
caggagggcagccccatcctgcgagacctcgtcctcagccccaaccaccagtacctctac
gccatgaccgagaagcaggtgacgcgggtgcctgtggagagctgtgtgcagtacacgtcc
tgtgagctgtgtctggggtcacgggacccccactgtggctggtgtgtcctgcacagcatc
tgctcgcggcgggacgcctgtgagcgagcagacgagccccagcgctttgctgcggacctg
ctgcagtgtgtgcagctgactgtgcagccccgcaatgtgtctgtcaccatgtcccaggtc
ccacttgtgctgcaggcctggaacgtgcctgacctctcagctggcgtcaactgctccttc
gaggacttcacggaatctgagagcgtcctggaggatggccggatccactgccgctcaccc
tccgcccgggaggtggcgcccatcacgcggggccagggagaccagcgggtggtgaaactc
tacctaaagtccaaggagacagggaagaagtttgcgtctgtggacttcgtcttctacaac
tgcagcgtccaccagtcctgcctgtcctgtgtcaacggctcctttccctgccactggtgc
aaataccgccacgtgtgcacacacaacgtggctgactgcgccttcctggagggccgtgtc
aacgtgtctgaggactgcccacagatcctgccctccacgcagatctacgtgccagtggga
gtggtaaaacccatcaccctggccgcacggaacctgccacagccacagtcaggccagcgt
ggatatgagtgcctcttccacatcccgggcagcccggcccgtgtcaccgccctgcgcttc
aacagctccagcctgcagtgccagaattcctcgtactcctacgaggggaacgatgtcagc
gacctgccagtgaacctgtcagtcgtgtggaacggcaactttgtcattgacaacccacag
aacatccaggcgcacctctacaagtgcccggccctgcgcgagagctgcggcctctgcctc
aaggccgacccgcgcttcgagtgcggatggtgcgtggccgagcgccgctgctccctgcga
caccactgcgctgccgacacacctgcatcgtggatgcacgcgcgtcacggcagcagtcgc
tgcaccgaccccaagatcctcaagctgtcccccgagacgggcccgaggcagggcggcacg
cggctcactatcacaggcgagaacctgggcctgcgattcgaagacgtgcgtctgggcgtg
cgcgtgggcaaggtgctgtgcagccctgtggagagcgagtacatcagtgcggagcagatc
gtctgtgagatcggggacgccagctccgtgcgtgcccatgacgccctggtggaggtgtgt
gtgcgggactgctcaccacactaccgcgccctgtcacccaagcgcttcaccttcgtgaca
ccaaccttctaccgtgtgagcccctcccgtgggcctctgtcagggggcacctggattggc
atcgagggaagccacctgaacgcaggcagtgatgtggctgtgtcggtcggtggccggccc
tgctccttctcctggaggaactcccgtgagatccggtgcctgacaccccccgggcagagc
cctggcagcgctcccatcatcatcaacatcaaccgcgcccagctcaccaaccctgaggtg
aagtacaactacaccgaggaccccaccatcctgaggatcgaccccgagtggagcatcaac
agcggtgggaccctcctgacggtcacaggcaccaacctggccactgtccgtgaaccccga
atccgggccaagtatggaggcattgagagggagaacggctgcctggtgtacaatgacacc
accatggtatgccgcgccccgtctgtggccaaccctgtgcgcagcccaccagagctgggg
gagcggccggatgagctgggcttcgtcatggacaacgtgcgctccctgcttgtgctcaac
tccacctccttcctctactaccctgaccccgtactggagccactcagccccactggcctg
ctggagctgaagcccagctccccactcatcctcaagggccggaacctcttgccacctgca
cccggcaactcccgactcaactacacggtgctcatcggctccacaccctgtaccctcacc
gtgtcggagacgcaactgctgtgcgaggcgcccaacctcactgggcagcacaaggtcacg
gtgcgggcaggtggcttcgagttctcgccagggacactgcaggtgtactcggacagcctg
ctgacgctgcctgccattgtgggcattggcggaggcgggggtctcctgctgctggtcatc
gtggctgtgctcatcgcctacaagcgcaagtcacgagatgctgaccgcacactcaagcgg
ctgcagctccagatggacaacctggagtcccgcgtggccctcgaatgcaaggaagccttt
gcagagctgcagacagacatccacgagctgaccaatgacctggacggtgccggcatcccc
ttccttgactaccggacatatgccatgcgggtgctctttcctgggatcgaggaccaccct
gtgctcaaggagatggaggtgcaggccaatgtggagaagtcgctgacactgttcgggcag
ctgctgaccaagaagcacttcctgctgaccttcatccgcacgctggaggcacagcgcagc
ttctccatgcgcgaccgcgggaatgtggcctcgctcatcatgacggccctgcagggcgag
atggaatacgccacaggcgtgctcaagcagctgctttccgacctcatcgagaagaacctg
gagagcaagaaccaccccaagctgctactgcgccggactgagtcggtggcagagaagatg
ctaactaactggttcaccttcctcttgtataagttcctcaaggagtgcgctggggagccg
ctgttcatgctgtactgcgccatcaagcagcagatggagaagggccccattgacgccatc
acgggtgaggcacgctactccctgagtgaggacaagctcatccggcagcagattgactac
aagacactgaccctgaactgtgtgaaccctgagaatgagaatgcacctgaggtgccggtg
aaggggctggactgtgacacggtcacccaggccaaggagaagctgctggacgctgcctac
aagggcgtgccctactcccagcggcccaaggccgcggacatggacctggagtggcgccag
ggccgcatggcgcgcatcatcctgcaggacgaggacgtcaccaccaagattgacaacgat
tggaagaggctgaacacactggctcactaccaggtgacagacgggtcctcggtggcactg
gtgcccaagcagacgtccgcctacaacatctccaactcctccaccttcaccaagtccctc
agcagatacgagagcatgctgcgcacggccagcagccccgacagcctgcgctcgcgcacg
cccatgatcacgcccgacctggagagcggcaccaagctgtggcacctggtgaagaaccac
gaccacctggaccagcgtgagggtgaccgcggcagcaagatggtctcggagatctacttg
acacggctactggccaccaagggcacactgcagaagtttgtggacgacctgtttgagacc
atcttcagcacggcacaccggggctcagccctgccgctggccatcaagtacatgttcgac
ttcctggatgagcaggccgacaagcaccagatccacgatgctgacgtgcgccacacctgg
aagagcaactgcctgcccctgcgcttctgggtgaacgtgatcaagaacccacagtttgtg
ttcgacattcacaagaacagcatcacggacgcctgcttgtcggtggtggcccagaccttc
atggactcctgctccacctctgagcacaagctgggcaaggactcaccctccaacaagctg
ctctacgccaaggacatccccaactacaagagctgggtggagaggtactatgcagacatc
gccaagatgccagccatcagcgaccaggacatgagtgcgtatctggctgagcagtcccgc
ctgcacctgagccagttcaacagcatgagcgccttgcacgagatctactcctacatcacc
aagtacaaggatgagatcctggcagccctggagaaggatgagcaggcgcggcggcagcgg
ctgcggagcaagctggagcaggtggtggacacgatggccctgagcagctga

KEGG   Homo sapiens (human): 5362Help
Entry
5362              CDS       T01001                                 

Gene name
PLXNA2, OCT, PLXN2
Definition
(RefSeq) plexin A2
  KO
K06820  plexin A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    5362 (PLXNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 TIG_plexin PSI RasGAP PSI_integrin
Motif
Other DBs
NCBI-GeneID: 5362
NCBI-ProteinID: NP_079455
OMIM: 601054
HGNC: 9100
Ensembl: ENSG00000076356
Vega: OTTHUMG00000036564
Pharos: O75051(Tbio)
UniProt: O75051
LinkDB All DBs
Structure
PDB: 

Position
1q32.2
AA seq 1894 aa AA seqDB search
MEQRRPWPRALEVDSRSVVLLSVVWVLLAPPAAGMPQFSTFHSENRDWTFNHLTVHQGTG
AVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSEVLTLTNNVNKLLIID
YSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKTGTMYGVIVRSEGEDG
KLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSLIKIPSDTLALVSHFD
IFYIYGFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRIVRLCKDDPKFHSYVSLPFGC
TRAGVEYRLLQAAYLAKPGDSLAQAFNITSQDDVLFAIFSKGQKQYHHPPDDSALCAFPI
RAINLQIKERLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFCGLDINQPLGGSTPVE
GLTLYTTSRDRMTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGS
PILRDMAFSIDQRYLYVMSERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNMCSRR
DKCQQAWEPNRFAASISQCVSLAVHPSSISVSEHSRLLSLVVSDAPDLSAGIACAFGNLT
EVEGQVSGSQVICISPGPKDVPVIPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCSAHQ
LCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQLVPTEEILIPVGEVKPI
TLKARNLPQPQSGQRGYECVLNIQGAIHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVD
FAVVWNGNFIIDNPQDLKVHLYKCAAQRESCGLCLKADRKFECGWCSGERRCTLHQHCTS
PSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAGVP
CTPLPGEYIIAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKSHQQYTFVNPSVLSLN
PIRGPESGGTMVTITGHYLGAGSSVAVYLGNQTCEFYGRSMSEIVCVSPPSSNGLGPVPV
SVSVDRAHVDSNLQFEYIDDPRVQRIEPEWSIASGHTPLTITGFNLDVIQEPRIRVKFNG
KESVNVCKVVNTTTLTCLAPSLTTDYRPGLDTVERPDEFGFVFNNVQSLLIYNDTKFIYY
PNPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGGAKLNYTVLIGETPCAVTVSETQLL
CEPPNLTGQHKVMVHVGGMVFSPGSVSVISDSLLTLPAIVSIAAGGSLLLIIVIIVLIAY
KRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPYLDYRTY
AMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSM
RDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKMLTN
WFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTL
ILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDLEWRQGRI
ARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISR
YDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKS
NCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLY
AKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKY
SEELIGALEQDEQARRQRLAYKVEQLINAMSIES
NT seq 5685 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaggcggccctggccccgggccctggaggtggacagccgctctgtggtcctg
ctctcagtggtctgggtgctgctggcccccccagcagccggcatgcctcagttcagcacc
ttccactctgagaatcgtgactggaccttcaaccacttgaccgtccaccaagggacgggg
gccgtctatgtgggggccatcaaccgggtctataagctgacaggcaacctgaccatccag
gtggctcataagacagggccagaagaggacaacaagtcttgttacccgcccctcatcgtg
cagccctgcagcgaagtgctcaccctcaccaacaatgtcaacaagctgctcatcattgac
tactctgagaaccgcctgctggcctgtgggagcctctaccagggggtctgcaagctgctg
cggctggatgacctcttcatcctggtggagccatcccacaagaaggagcactacctgtcc
agtgtcaacaagacgggcaccatgtacggggtgattgtgcgctctgagggtgaggatggc
aagctcttcatcggcacggctgtggatgggaagcaggattacttcccgaccctgtccagc
cggaagctgccccgagaccctgagtcctcagccatgctcgactatgagctacacagcgat
tttgtctcctctctcatcaagatcccttcagacaccctggccctggtctcccactttgac
atcttctacatctacggctttgctagtgggggctttgtctactttctcactgtccagccc
gagacccctgagggtgtggccatcaactccgctggagacctcttctacacctcacgcatc
gtgcggctctgcaaggatgaccccaagttccactcatacgtgtccctgcccttcggctgc
acccgggccggggtggaataccgcctcctgcaggctgcttacctggccaagcctggggac
tcactggcccaggccttcaatatcaccagccaggacgatgtactctttgccatcttctcc
aaagggcagaagcagtatcaccacccgcccgatgactctgccctgtgtgccttccctatc
cgggccatcaacttgcagatcaaggagcgcctgcagtcctgctaccagggcgagggcaac
ctggagctcaactggctgctggggaaggacgtccagtgcaccaaggcgcctgtccccatc
gatgataacttctgtggactggacatcaaccagcccctgggaggctcaactccagtggag
ggcctgaccctgtacaccaccagcagggaccgcatgacctctgtggcctcctacgtttac
aacggctacagcgtggtttttgtggggactaagagtggcaagctgaaaaagattcgggcc
gacggtcccccccatggtggggtccagtacgagatggtctctgtgctcaaggacggaagc
cccatcctccgggacatggccttctccattgatcagcgctacctgtacgtcatgtctgag
agacaggtcaccagggtccccgtggagtcatgtgagcagtatacgacttgtggggagtgc
ctgagctctggggaccctcactgtggctggtgtgccctgcacaacatgtgctcccgcagg
gacaaatgccaacaggcctgggaacctaatcgatttgctgccagcatcagccagtgtgtg
agccttgcagtgcatcccagcagcatctcagtatctgagcacagccggttgcttagcctg
gtagtgagtgatgctcctgatctatctgcgggtatcgcctgtgcctttgggaacctgaca
gaggtggaggggcaggtgtccgggagccaggtcatctgcatctcacctgggcccaaggat
gtccctgtcatcccgctggatcaagactggtttgggctggagctacagctgaggtccaag
gagacagggaagatatttgtcagcaccgagttcaagttttacaactgcagtgcccaccaa
ctgtgcctgtcctgtgtcaacagcgccttccgctgccattggtgcaagtaccgcaacctc
tgcactcatgaccccaccacctgctccttccaggagggccggatcaatatttcagaggac
tgtccccagctggtgcccacagaggagatcttgattccagtcggggaggtaaagccaatc
acccttaaggcgcgaaatctgccccagccgcagtccggccagcgaggctatgagtgtgtc
ctcaacatacaaggagccatccaccgggtccccgctctgcgcttcaacagctccagcgtt
cagtgtcagaacagctcgtaccagtatgatggcatggacatcagcaatctggccgtggat
ttcgctgtggtgtggaacggcaatttcatcattgacaaccctcaggacctgaaagtccat
ctctacaagtgtgcagcccagcgggagagctgcggcctctgcctcaaggccgaccggaag
tttgagtgtggctggtgcagcggcgagcgcaggtgcaccctccaccagcactgtaccagc
ccttccagcccctggctcgactggtccagccacaatgtcaagtgctccaaccctcaaatc
accgagattttgacggtgtctggaccgccggaaggagggacgcgagtgaccatccatggc
gtgaacctgggtctggacttctccgagatcgcccaccatgtgcaggtggctggggtgccc
tgcacgcccctcccaggggaatacatcatcgctgagcagattgtctgtgagatgggccat
gccctcgtgggaaccacctccgggccagtacgcctgtgtattggcgagtgtaagccagag
ttcatgacgaagtcccatcagcagtacaccttcgtgaacccttctgtgctgtcactcaac
ccaatccgaggtcccgagtcaggaggcactatggtgaccattaccggccattaccttggg
gctgggagcagcgtggcagtctacctgggcaaccagacctgcgagttctacgggaggtca
atgagtgagatcgtgtgtgtctcacccccatcatccaatggccttggcccggtccctgtt
tctgtgagtgtcgaccgagcccatgtggatagcaacctgcagtttgagtacatagatgac
cctcgggtccagcgcatcgagccagagtggagcattgccagtggccacacacccctgacc
atcacaggcttcaacctggatgtcattcaggagccaaggatccgagtcaaattcaatggc
aaagaatctgtcaatgtgtgtaaagttgtgaacacaaccaccctcacctgcctggcaccc
tctctgaccacggactaccgccctggcctggacactgtggaacgcccagatgagtttgga
tttgtctttaacaatgtccaatccttgctaatttacaacgacaccaagtttatctactac
cccaacccgacctttgaactgcttagccctactggagtcttggatcaaaagccaggatcg
cccatcattctgaagggcaaaaacctctgccctcctgcctctggaggggccaaactcaac
tacactgtgctcatcggagagaccccttgtgctgtcaccgtatctgagacccagcttctc
tgcgagcctcccaacctcaccgggcagcacaaggtcatggttcacgtgggcgggatggtg
ttctcgcctggctcggtgagtgtcatctcagacagcttgctgaccctgccagccatcgtc
agcatcgcggccggcggcagcctcctcctcatcatcgtcatcatcgtcctcattgcctac
aagcgcaagtctcgagaaaatgacctcactctcaagcggctgcaaatgcagatggacaat
ctggagtcccgtgtggccttggagtgcaaggaagcttttgctgagctccagacggatatc
aatgagttgaccagtgacctggaccgctcaggaatcccttacctggactatcgtacctac
gctatgcgagtcctgttcccgggcatcgaggaccaccccgtcctgcgggagctggaggta
caaggaaacgggcagcagcacgtggagaaggccctgaagctctttgcccagctcatcaac
aacaaggtgttcctgctgaccttcatccgcaccctggagctgcagcgcagtttctccatg
cgcgaccggggcaacgtggcttcgctcatcatgaccggcctgcagggccgcctggaatat
gccactgatgtcctcaagcagctgctctctgacctcatcgataagaacctggagaacaag
aaccaccccaagctgctactccggaggacagagtctgtggctgaaaagatgctgaccaat
tggttcgccttcctcctgcacaagttcctaaaggagtgcgcaggggagccactcttcatg
ctatactgtgccatcaagcagcagatggagaagggccccattgatgccatcacgggcgag
gcccgctactccctgagcgaggacaagctcatccggcagcagatcgagtacaagaccctg
atcctgaactgcgtcaaccctgacaacgagaacagtccagagatcccagtgaaggtgtta
aactgtgacaccatcacacaggtcaaggagaagattcttgatgccgtgtataagaatgtg
ccctattcccagcggccgagggcagtggacatggacttggagtggcgccaaggccggatc
gcccgggtcgtgctgcaagatgaggacatcaccaccaagattgagggtgactggaagcgg
ctcaacacactgatgcattatcaggtgtcagacaggtcggtggtggctctggtccccaaa
cagacctcctcctacaacatccctgcctctgccagcatctcccggacgtccatcagcaga
tacgactcctccttcaggtatacgggcagccccgacagcctgcggtcccgggccccgatg
atcaccccagacctggaaagtggggtcaaggtgtggcatctggtgaagaaccatgaccac
ggtgaccagaaggagggtgaccggggcagcaagatggtgtccgagatctacctgacccgg
ctactggccaccaagggcaccctgcagaagtttgtggacgacttgtttgagaccttgttc
agcactgtgcaccggggcagcgctctccccctggccatcaagtacatgtttgatttccta
gatgagcaggcagacaggcacagcatccatgacacagatgtgcggcacacctggaaaagc
aactgcctccctctgcgcttctgggtgaacgtgattaagaacccccagttcgtgtttgac
atccacaagggcagcatcacggacgcctgcctctctgtggtggcccagaccttcatggac
tcttgttcaacgtcagagcaccggctgggcaaggactccccctccaacaagctgctctat
gccaaggacatccccagctacaagagctgggtggagagatactacgcagacatcgccaag
ctcccagccatcagtgaccaggacatgaatgcctacctcgccgagcagtcccgcctgcac
gccgtggagttcaacatgctgagtgccctcaatgagatctactcctatgtcagcaagtat
agtgaggagctcatcggggccctagagcaggatgagcaggcacggcggcagcggctggct
tataaggtggagcagctcattaatgccatgtccattgagagctga

KEGG   Homo sapiens (human): 55558Help
Entry
55558             CDS       T01001                                 

Gene name
PLXNA3, 6.3, HSSEXGENE, PLXN3, PLXN4, XAP-6
Definition
(RefSeq) plexin A3
  KO
K06820  plexin A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    55558 (PLXNA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 TIG_plexin PSI
Motif
Other DBs
NCBI-GeneID: 55558
NCBI-ProteinID: NP_059984
OMIM: 300022
HGNC: 9101
Ensembl: ENSG00000130827
Vega: OTTHUMG00000033290
Pharos: P51805(Tdark)
UniProt: P51805
LinkDB All DBs
Position
Xq28
AA seq 1871 aa AA seqDB search
MPSVCLLLLLFLAVGGALGNRPFRAFVVTDTTLTHLAVHRVTGEVFVGAVNRVFKLAPNL
TELRAHVTGPVEDNARCYPPPSMRVCAHRLAPVDNINKLLLIDYAARRLVACGSIWQGIC
QFLRLDDLFKLGEPHHRKEHYLSGAQEPDSMAGVIVEQGQGPSKLFVGTAVDGKSEYFPT
LSSRKLISDEDSADMFSLVYQDEFVSSQIKIPSDTLSLYPAFDIYYIYGFVSASFVYFLT
LQLDTQQTLLDTAGEKFFTSKIVRMCAGDSEFYSYVEFPIGCSWRGVEYRLVQSAHLAKP
GLLLAQALGVPADEDVLFTIFSQGQKNRASPPRQTILCLFTLSNINAHIRRRIQSCYRGE
GTLALPWLLNKELPCINTPMQINGNFCGLVLNQPLGGLHVIEGLPLLADSTDGMASVAAY
TYRQHSVVFIGTRSGSLKKVRVDGFQDAHLYETVPVVDGSPILRDLLFSPDHRHIYLLSE
KQVSQLPVETCEQYQSCAACLGSGDPHCGWCVLRHRCCREGACLGASAPHGFAEELSKCV
QVRVRPNNVSVTSPGVQLTVTLHNVPDLSAGVSCAFEAAAENEAVLLPSGELLCPSPSLQ
ELRALTRGHGATRTVRLQLLSKETGVRFAGADFVFYNCSVLQSCMSCVGSPYPCHWCKYR
HTCTSRPHECSFQEGRVHSPEGCPEILPSGDLLIPVGVMQPLTLRAKNLPQPQSGQKNYE
CVVRVQGRQQRVPAVRFNSSSVQCQNASYSYEGDEHGDTELDFSVVWDGDFPIDKPPSFR
ALLYKCWAQRPSCGLCLKADPRFNCGWCISEHRCQLRTHCPAPKTNWMHLSQKGTRCSHP
RITQIHPLVGPKEGGTRVTIVGENLGLLSREVGLRVAGVRCNSIPAEYISAERIVCEMEE
SLVPSPPPGPVELCVGDCSADFRTQSEQVYSFVTPTFDQVSPSRGPASGGTRLTISGSSL
DAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYT
QDPTVTRLEPTWSIINGSTAITVSGTHLLTVQEPRVRAKYRGIETTNTCQVINDTAMLCK
APGIFLGRPQPRAQGEHPDEFGFLLDHVQTARSLNRSSFTYYPDPSFEPLGPSGVLDVKP
GSHVVLKGKNLIPAAAGSSRLNYTVLIGGQPCSLTVSDTQLLCDSPSQTGRQPVMVLVGG
LEFWLGTLHISAERALTLPAMMGLAAGGGLLLLAITAVLVAYKRKTQDADRTLKRLQLQM
DNLESRVALECKEAFAELQTDINELTNHMDEVQIPFLDYRTYAVRVLFPGIEAHPVLKEL
DTPPNVEKALRLFGQLLHSRAFVLTFIHTLEAQSSFSMRDRGTVASLTMVALQSRLDYAT
GLLKQLLADLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLHKFLKECAGEPLFLLY
CAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVCPENEGSAQVPVKVLNC
DSITQAKDKLLDTVYKGIPYSQRPKAEDMDLEWRQGRMTRIILQDEDVTTKIECDWKRLN
SLAHYQVTDGSLVALVPKQVSAYNMANSFTFTRSLSRYESLLRTASSPDSLRSRAPMITP
DQETGTKLWHLVKNHDHADHREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFSTA
HRGSALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHK
NSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDIAKMAS
ISDQDMDAYLVEQSRLHASDFSVLSALNELYFYVTKYRQEILTALDRDASCRKHKLRQKL
EQIISLVSSDS
NT seq 5616 nt NT seq  +upstreamnt  +downstreamnt
atgccctctgtctgcctcctcctgctgctcttccttgccgtggggggggccctgggcaac
aggcccttccgtgccttcgtggtgacagacaccacgcttacccacctggctgtgcaccgg
gtgactggggaggtgttcgtgggcgcagtgaaccgagtctttaagctggcccccaacctg
actgagctgcgggcccatgtcacggggcccgtcgaggacaacgctcgctgctacccgccc
cccagcatgcgcgtgtgtgcccaccgcctggcccccgtggacaacatcaacaagctgctg
ctcatagactatgcggcccgccgcctggtggcctgcggcagcatctggcagggcatctgc
cagttcctgcgtctggacgacctcttcaagctgggtgagccgcaccaccgcaaggagcac
tacctgtcgggggcccaggagcccgactccatggctggtgtcattgtggagcagggccag
gggcccagcaagctgtttgtgggcactgctgtcgacggcaagtcggagtacttccccacc
ttgagctcccgcaagctcatcagtgatgaagacagcgcggacatgttcagtctcgtgtac
caggatgagtttgtgtcctcccagatcaagatcccctcagacacgctgtccttgtaccct
gcctttgacatctactacatctacggcttcgtcagcgcctccttcgtgtacttcctgacg
ctgcagctggacacccagcagacgctgttggacacagcgggcgagaaatttttcacgtcc
aagatcgtgcgcatgtgcgcgggagactcagagttctactcatacgtggaattccccatc
ggctgctcctggcgcggcgtggagtaccgcttggtgcagagcgcccacctggccaagcct
ggcctgctgctggcccaggccctgggcgtgccggctgatgaggacgtcctcttcaccatc
ttctctcagggccagaagaaccgggccagcccaccccggcagaccatcctctgcctcttc
accctcagcaacatcaatgcccacatccggcgccgcatccagtcctgctatcgtggggag
ggcactctggctctgccctggctgctgaacaaggagctgccctgcatcaacacccccatg
cagatcaacggcaacttctgtgggctggtgttgaaccagcctctgggaggcctgcatgtg
atcgaggggctgcccctgctggccgacagcaccgacggcatggccagcgtggccgcctac
acctaccgccagcactctgtggtcttcattggcacgcgcagcggcagcttgaagaaggtg
cgggtcgatggcttccaggatgcccacctgtatgagacagtccccgtggtggatggcagc
cccatcctccgagacctgctcttcagcccggaccaccggcacatctatctcctgagtgag
aagcaggtgagccagctcccggtggagacctgtgagcagtaccagagctgcgcagcctgc
ctgggctccggggacccgcactgtggttggtgtgtgctgcgacacaggtgctgccgcgaa
ggggcctgtctgggcgcctctgccccacacggctttgctgaggagctgagcaagtgtgtc
caggtgcgggtccggcccaacaatgtgtcagtgacgtcacctggggtgcagctgaccgtc
accctgcacaacgtgccagacctcagtgcgggcgtgagctgcgccttcgaggcggcggcg
gagaacgaggcggtcctgctgccctccggtgaactgctctgcccctcaccctccctccag
gagctccgagctcttaccagggggcatggggccacccgcactgtgcggctgcagcttctc
tccaaggagacaggcgtgaggtttgccggtgctgactttgtcttctacaactgcagcgtc
ctccagtcgtgcatgtcctgtgttggcagcccttacccctgccactggtgtaagtaccgc
cacacgtgtaccagccgcccccacgagtgctccttccaggagggcagggtccacagccct
gagggctgccctgagatcctgcccagtggggacctcctgatccccgttggggtcatgcag
cctcttaccttgcgggctaagaacctacctcagccgcagtcgggccagaagaactatgag
tgcgtggtgcgggtgcaggggcggcagcagcgggtgcctgccgtgcgcttcaacagcagc
agtgtgcagtgccagaacgcctcgtactcctatgaaggtgatgagcatggtgacaccgag
ctggacttttccgtggtctgggatggagacttccccatagacaagcctcccagcttccga
gccctcctgtacaagtgctgggcgcagcggcccagctgtggcctctgcctcaaggctgat
ccccgcttcaactgtggctggtgcatctcagagcacaggtgccagctgcggacccactgc
ccggccccgaagaccaactggatgcacctgagccagaagggcacccggtgcagccacccc
cgcatcacgcagatccaccctctcgtggggcccaaggaaggaggcacccgggtcaccatc
gtgggtgagaacctgggcctcttgtcccgagaggtgggcctgcgggtggctggcgtgcgt
tgcaactccattccggccgagtacatcagtgctgagaggatcgtgtgtgagatggaggag
tcgctggtgcccagcccgccgccggggcccgtggagctgtgtgtgggtgactgttcagcc
gacttccgcacgcagtcggagcaggtctacagctttgtgaccccaacgtttgaccaagtg
agtcccagccgtggcccggcgtccgggggcacacggcttaccatctcaggcagctctctg
gatgctggcagcagggtcacagtgactgtgagggacagcgagtgccagtttgtaaggaga
gatgccaaggcgatcgtgtgcatctcacctctctccaccctgggccccagccaggccccc
atcacacttgccattgaccgggctaacatctccagccccgggctcatctacacctacact
caggaccccaccgtcacccgccttgagcccacctggagcatcatcaatggaagcactgcc
atcactgtgagtgggacccacctgctgacggtccaggagccccgggtccgtgccaagtac
cgcggcattgagaccaccaatacatgccaagtgatcaacgacactgccatgctgtgtaag
gcccccggcatctttcttgggcggccccagcctcgggcgcaaggcgagcaccctgatgag
tttggcttcctgctggaccacgtgcaaacggcccgctccctcaaccgctcctcctttacc
tactaccctgatcccagctttgagccgctggggccctctggcgtgctggacgtcaaaccg
ggctcccacgtggtgctgaagggcaagaacctgattcccgctgcagccggcagctcccgc
ctcaactacactgtgctgataggaggccagccgtgttcgctcactgtctcggacacacaa
ctcctgtgcgactcacccagccagactggccggcagcctgtcatggtgctggtgggtggc
ctggagttctggctgggcaccctgcacatctcggcagagcgggcgctgaccctaccggcc
atgatggggctggcggcggggggtgggctcctgctgctggccatcacagccgtgctggtg
gcctacaagcgcaagactcaggacgcggaccgtaccctcaagcgtctgcagctgcagatg
gacaacctggagtcccgtgtggccctggagtgcaaggaagcttttgcagagctgcagacg
gacatcaatgagctgactaaccacatggacgaggtgcagatccccttcctggactaccgg
acttacgccgtgcgcgtgctcttcccgggcatcgaggcccacccggtgctcaaggagctg
gatacgccacccaacgtggagaaggccctgcgcctcttcgggcagctgctgcacagccgc
gcgttcgtgcttaccttcatccacacgctggaggcccagagcagcttctccatgcgcgac
cgcggcaccgtggcctcgctcaccatggtggccctgcagagccggctcgactatgccacg
gggctgctcaagcaactgctggccgacctcatcgagaagaacctcgagagcaagaaccac
cccaagctgctgctacgcaggacagagtcagtggctgagaagatgcttaccaactggttc
acgttcctgctgcataagtttctgaaggagtgtgctggggagcctctcttcctgctttac
tgtgccatcaagcagcagatggagaagggccccattgatgccatcacgggcgaggcacga
tactccctgagcgaggacaagctcatccgtcagcagatcgactacaagacactgaccctt
cactgcgtgtgtccggagaacgagggcagcgcccaggtcccagtgaaggttctcaactgt
gacagcatcacccaggccaaagataagctgctggacactgtgtacaagggcattccgtac
tcccagcgtcccaaagctgaggacatggacctggagtggcgccagggccgcatgactcgc
atcatcctccaggatgaggatgtcaccaccaagatcgagtgtgactggaagaggctcaac
tcactggcccactaccaggtgacagacggttccttggtggcattggtgcccaaacaagtg
tctgcctataacatggccaactccttcaccttcacccgctccctcagccgctacgagagc
ttgctccgcacggccagcagccctgatagcctccgctcacgggcacccatgattacgcct
gaccaggagacaggcaccaaattgtggcacctggtgaaaaaccacgaccatgccgaccat
cgcgagggggaccgtggcagcaagatggtctccgagatctacctgacacggctgctggcc
accaagggcacactgcagaagttcgtggatgacctctttgagacagtgttcagcacagcc
caccggggctcggccctgcccctggccatcaagtacatgttcgacttcctggatgagcag
gcggaccagcgccagatcagcgaccccgatgtgcgccacacctggaagagcaactgcctg
ccgctgcgcttctgggtgaatgtgatcaagaacccgcagttcgtgttcgacatccacaag
aacagcatcacggatgcctgcctgtcggtggtagcccagaccttcatggactcctgctct
acatccgagcaccgcctggggaaggactcgccctccaacaaactgctctacgccaaggac
atccccaactacaagagctgggtggagaggtattatcgagacattgcaaagatggcatcc
atcagcgaccaggacatggatgcctacctggtggagcagtcccgcctccacgccagcgac
ttcagcgtcctgagtgcgctcaacgagctgtatttctatgtcaccaagtaccgccaggag
attctcacggctctggaccgagatgcctcttgtcggaagcataagttgcggcagaaactg
gaacagatcatcagcctcgtgtccagcgacagctaa

KEGG   Homo sapiens (human): 91584Help
Entry
91584             CDS       T01001                                 

Gene name
PLXNA4, FAYV2820, PLEXA4, PLXNA4A, PLXNA4B, PRO34003
Definition
(RefSeq) plexin A4
  KO
K06820  plexin A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    91584 (PLXNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 TIG_plexin PSI PSI_integrin RasGAP
Motif
Other DBs
NCBI-GeneID: 91584
NCBI-ProteinID: NP_065962
OMIM: 604280
HGNC: 9102
Ensembl: ENSG00000221866
Vega: OTTHUMG00000155108
Pharos: Q9HCM2(Tbio)
UniProt: Q9HCM2 A0A024R7A6
LinkDB All DBs
Structure
PDB: 

Position
7q32.3
AA seq 1894 aa AA seqDB search
MKAMPWNWTCLLSHLLMVGMGSSTLLTRQPAPLSQKQRSFVTFRGEPAEGFNHLVVDERT
GHIYLGAVNRIYKLSSDLKVLVTHETGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLI
DYKENRLIACGSLYQGICKLLRLEDLFKLGEPYHKKEHYLSGVNESGSVFGVIVSYSNLD
DKLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTIIPDF
DIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGC
ERSGVEYRLLQAAYLSKAGAVLGRTLGVHPDDDLLFTVFSKGQKRKMKSLDESALCIFIL
KQINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSDMVR
GIPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGP
VLRDMAFSKDHEQLYIMSERQLTRVPVESCGQYQSCGECLGSGDPHCGWCVLHNTCTRKE
RCERSKEPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSE
MDGLVVGNQIQCYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHN
SCLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPI
TLKAKNLPQPQSGQRGYECILNIQGSEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVE
LTVVWNGHFNIDNPAQNKVHLYKCGAMRESCGLCLKADPDFACGWCQGPGQCTLRQHCPA
QESQWLELSGAKSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVE
CSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLK
PSRGPMSGGTQVTITGTNLNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVS
VQVDRAKIHQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGK
EHINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYP
NPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLL
CESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAY
KRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTY
TMRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSM
RDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTN
WFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTL
VLSCVSPDNANSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSG
ARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSASK
YENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKS
NCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLY
AKDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGKY
SEEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
NT seq 5685 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgccctggaactggacctgccttctctcccacctcctcatggtgggcatg
ggctcctccactttgctcacccggcagccagccccgctgtcccagaagcagcggtcattt
gtcacattccgaggagagcccgccgagggtttcaatcacctggtggtggatgagaggaca
ggacacatttacttgggggccgtcaatcggatttacaagctctccagcgacctgaaggtc
ttggtgacgcatgagacagggccggacgaggacaaccccaagtgttacccaccccgcatc
gtccagacctgcaatgagcccctgaccaccaccaacaatgtcaacaagatgctcctcata
gactacaaggagaacaggctgattgcctgtgggagcctgtaccaaggcatctgcaagctg
ctgaggctggaggacctcttcaagctgggggagccttatcataagaaggagcactatctg
tcaggtgtcaacgagagcggctcagtctttggagtgatcgtctcctacagcaacctggat
gacaagctgttcattgccacggcagtggatgggaagcccgagtattttcccaccatctcc
agccggaaactgaccaagaactctgaggcggatggcatgttcgcgtacgtcttccatgat
gagttcgtggcctcgatgattaagatcccttcggacaccttcaccatcatccctgacttt
gatatctactatgtctatggttttagcagtggcaactttgtctactttttgaccctccaa
cctgagatggtgtctccaccaggctccaccaccaaggagcaggtgtatacatccaagctc
gtgaggctttgcaaggaggacacagccttcaactcctatgtagaggtgcccattggctgt
gagcgcagtggggtggagtaccgcctgctgcaggctgcctacctgtccaaagcgggggcc
gtgcttggcaggacccttggagtccatccagatgatgacctgctcttcaccgtcttctcc
aagggccagaagcggaaaatgaaatccctggatgagtcggccctgtgcatcttcatcttg
aagcagataaatgaccgcattaaggagcggctgcagtcttgttaccggggcgagggcacg
ctggacctggcctggctcaaggtgaaggacatcccctgcagcagtgcgctcttaaccatt
gacgataacttctgtggcctggacatgaatgctcccctgggagtgtccgacatggtgcgt
ggaattcccgtcttcacggaggacagggaccgcatgacgtctgtcatcgcatatgtctac
aagaaccactctctggcctttgtgggcaccaaaagtggcaagctgaagaagatccgggtg
gatggacccaggggcaacgccctccagtatgagacggtgcaggtggtggaccccggccca
gtcctccgggatatggccttctccaaggaccacgagcaactctacatcatgtcagagagg
cagctcaccagagtccctgtggagtcctgtggtcagtatcagagctgcggcgagtgcctt
ggctcaggcgacccccactgtggctggtgtgtgctgcacaacacttgcacccggaaggag
cggtgtgagcggtccaaggagccccgcaggtttgcctcggagatgaagcagtgtgtccgg
ctgacggtccatcccaacaatatctccgtctctcagtacaacgtgctgctggtcctggag
acgtacaatgtcccggagctgtcagctggcgtcaactgcacctttgaggacctgtcagag
atggatgggctggtcgtgggcaatcagatccagtgctactcccctgcagccaaggaggtg
ccccggatcatcacagagaatggggaccaccatgtcgtacagcttcagctcaaatcaaag
gagaccggcatgaccttcgccagcaccagctttgtcttctacaattgcagcgtccacaat
tcgtgcctgtcctgcgtggagagtccataccgctgccactggtgtaaataccggcatgtc
tgcacccatgaccccaagacctgctccttccaggaaggccgagtgaagctgcccgaggac
tgcccccagctgctgcgagtggacaagatcctggtgcccgtggaggtgatcaagcctatc
acgctgaaggccaagaacctcccccagccccagtctgggcagcgtggctacgaatgcatc
ctcaacattcagggcagcgagcagcgagtgcccgccctgcgcttcaacagctccagcgta
cagtgccagaacacctcttattcctatgaagggatggagatcaacaacctgcccgtggag
ttgacagtcgtgtggaatgggcacttcaacattgacaacccagctcagaataaagttcac
ctctacaagtgtggagccatgcgtgagagctgcgggctgtgcctcaaggctgacccagac
ttcgcatgtggctggtgccagggcccaggccagtgcaccctgcgccagcactgccctgcc
caggagagccagtggctggagctgtctggtgccaaaagcaagtgcacaaacccccgcatc
acagagataatcccggtgacaggcccccgggaagggggcaccaaggtcactatccgaggg
gagaacctgggcctggaatttcgcgacatcgcctcccatgtcaaggttgctggcgtggag
tgcagccctttagtggatggttacatccctgcagaacagatcgtgtgtgagatgggggag
gccaagcccagccagcatgcaggcttcgtggagatctgcgtggctgtgtgtcggcctgaa
ttcatggcccggtcctcacagctctattacttcatgacactgactctctcagatctgaag
cccagccgggggcccatgtccggagggacccaagtgaccatcacaggcaccaacctgaat
gccggaagcaacgtggtggtgatgtttggaaagcagccctgtctcttccacaggcgatct
ccatcctacattgtctgcaacaccacatcctcagatgaggtgctagagatgaaggtgtcg
gtgcaggtggacagggccaagatccaccaggacctggtctttcagtatgtggaagacccc
accatcgtgcggattgagccagaatggagcattgtcagtggaaacacacccatcgccgta
tgggggacccacctggacctcatacagaacccccagatccgtgccaagcatggagggaag
gagcacatcaatatctgtgaggttctgaacgctactgagatgacctgtcaggcgcccgcc
ctcgctctgggtcctgaccaccagtcagacctgaccgagaggcccgaggagtttggcttc
atcctggacaacgtccagtccctgctcatcctcaacaagaccaacttcacctactatccc
aacccggtgtttgaggcctttggtccctcaggaatcctggagctcaagcctggcacgccc
atcatcctaaagggcaagaacctgatcccgcctgtggctgggggcaacgtgaagctgaac
tacactgtgctggttggggagaagccgtgcaccgtgaccgtgtcagatgtccagctgctc
tgcgagtcccccaacctcatcggcaggcacaaagtgatggcccgtgtcggtggcatggag
tactccccggggatggtgtacattgccccggacagcccgctcagcctgcccgccatcgtc
agcatcgcagtggctggcggcctcctcatcattttcatcgtggccgtgctcattgcctat
aaacgcaagtcccgcgaaagtgacctcacgctgaagcggctgcagatgcagatggacaac
ctggagtcccgtgtggccctggagtgcaaggaagcctttgccgagctgcagacggacatc
catgagctgaccagtgacctggatggagccgggattccgttcctggactatagaacttac
accatgcgggtgctgttcccaggaattgaagaccaccctgtcctccgggaccttgaggtc
ccgggctaccggcaggagcgtgtggagaaaggcctgaagctcttcgcccagctcatcaac
aacaaggtgttcctgctgtccttcatccgcacgcttgagtcccagcgtagcttctccatg
cgcgaccgtggcaacgtggcctcactcatcatgaccgtgctgcagagcaagctggagtac
gccactgatgtgctgaagcagctgctggccgacctcattgacaagaacctggagagcaag
aaccaccctaagctgctgctcaggaggactgagtcagtggctgagaagatgctgaccaat
tggtttactttcctcctctacaagttcctcaaggagtgtgctggggagcccctcttctcc
ctgttctgtgccatcaagcagcagatggagaagggccccattgacgccatcacgggcgag
gcccgctactccttgagcgaggacaagctcatccgccagcagattgactacaaaaccctg
gtcctgagctgtgtcagcccagacaatgccaacagccccgaggtcccagtaaagatcctc
aactgtgacaccatcactcaggtcaaggagaagattctggatgccatcttcaagaatgtg
ccttgctcccaccggcccaaagctgcagatatggatctggagtggcgacaaggaagtggg
gcaaggatgatcttgcaggatgaagacatcaccaccaagattgagaatgattggaagcga
ctgaacacactggcccactaccaggtgccagatggttccgtggtggcattagtgtccaag
caggtgacagcctataacgcagtgaacaactccaccgtctccaggacctcagcaagtaaa
tatgaaaacatgatccggtacacgggcagccccgacagcctccgctcacggacacctatg
atcactcctgacctggagagtggagtcaagatgtggcacctagtgaagaaccacgagcac
ggagaccagaaggagggggaccgggggagcaagatggtgtctgaaatctacctgacccga
ctcctggccactaagggcacactgcagaagtttgtggatgacctctttgagaccatcttc
agcacggcacaccgtggctctgccctgcccctggccatcaagtacatgtttgacttcctg
gatgagcaggctgataaacatggcattcatgacccgcacgtccgccatacctggaagagc
aattgcctgcccctgaggttttgggtcaacatgatcaagaacccgcagtttgtgtttgac
atccataagaacagcatcacagacgcctgcctctctgtggtggctcagaccttcatggac
tcttgctccacgtcagagcaccggctgggcaaggactcgccctccaacaagctgctgtat
gccaaggacatccccagctacaagaattgggtggagaggtattactcagacatagggaag
atgccagccatcagcgaccaagacatgaacgcatacctggctgagcagtcccggatgcac
atgaatgagttcaacaccatgagtgcactctcagagatcttctcctatgtgggcaaatac
agcgaggagatccttggacctctggaccacgatgaccagtgtgggaagcagaaactggcc
tacaaactagaacaagtcataaccctcatgagcttagacagctga

DBGET integrated database retrieval system