KEGG   Homo sapiens (human): 53630
Entry
53630             CDS       T01001                                 

Gene name
BCO1, BCDO, BCDO1, BCMO, BCMO1, BCO
Definition
(RefSeq) beta-carotene oxygenase 1
  KO
K00515  beta-carotene 15,15'-dioxygenase [EC:1.13.11.63]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Disease
H01266  Hypercarotenemia and vitamin A deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    53630 (BCO1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.63  beta-carotene 15,15'-dioxygenase
     53630 (BCO1)
SSDB
Motif
Pfam: RPE65 DUF4096
Other DBs
NCBI-GeneID: 53630
NCBI-ProteinID: NP_059125
OMIM: 605748
HGNC: 13815
Ensembl: ENSG00000135697
Vega: OTTHUMG00000137630
Pharos: Q9HAY6(Tbio)
UniProt: Q9HAY6
LinkDB
Position
16q23.2
AA seq 547 aa
MDIIFGRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSF
TIRDGEVYYRSKYLRSDTYNTNIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATSETNYIRKINPQTLETLEKVDYRKYVAVNLATSHPHYDEAGN
VLNMGTSIVEKGKTKYVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSRSLLSPSYYHSFG
VTENYVIFLEQPFRLDILKMATAYIRRMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFY
TDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFA
VPLHVDKNAEVGTNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRY
VFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVS
TDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASD
CHGAPLT
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggatataatatttggcaggaataggaaagaacagctggagcctgtgagggccaaagtg
acaggcaagattccagcatggctgcagggaaccctgctccgcaatgggcctgggatgcac
acagttggggagtccagatacaaccattggttcgacggccttgccctgctccacagcttc
accatcagagacggtgaagtctattacaggagcaaatacctgagaagcgatacctacaac
accaatattgaggcaaacaggattgtggtgtctgagtttggaacaatggcctatccggac
ccctgcaaaaacatattttccaaagctttctcctacttgtctcacaccatccccgatttc
accgacaactgcctgatcaacatcatgaagtgcggagaagacttctacgcgacctcagag
accaattacatcaggaaaatcaacccacagactctggaaaccctggagaaggttgattat
cgtaaatacgtggcggtaaatctggcaacgtcacatccccattatgatgaggctggaaat
gttctaaacatgggcacatccattgtggaaaaggggaagacaaagtatgtgatttttaag
atccctgccacagtaccagagggcaagaagcaggggaagagcccctggaagcacacagag
gtgttctgctccatcccatcccgctccctgctctccccaagctactaccacagctttgga
gtcaccgagaactatgtcatcttccttgagcagcctttcaggttggatattctcaagatg
gcaaccgcatacatccggagaatgagctgggcctcctgcctggctttccacagggaggag
aagacttatatccacatcatcgaccaaaggaccaggcagcctgtgcagaccaagttttac
acagacgccatggtggtcttccatcacgtcaacgcctacgaagaggacggctgcatcgtg
tttgacgtcattgcctacgaggacaacagcctctaccagctcttctacctggccaacctg
aaccaggacttcaaggagaactccaggctcacctcggtccccaccctcaggaggtttgcc
gtgcccctccacgtggacaagaatgcagaagtgggcacaaatttaatcaaagtggcatct
acaacagccacggccctgaaggaagaagatggccaagtctactgccagccggaatttctt
tatgaaggcttagagcttccacgggtcaattatgctcacaatggaaagcaataccgatat
gtctttgctacaggagttcagtggagtccaatcccaaccaagataataaaatatgacatt
ctcacaaagtcatccttaaaatggagagaggacgactgctggccagcggaacccctgttt
gtgcccgcgccaggtgccaaggatgaggatgacggagtaatcttatcagccattgtctct
actgatccccaaaagctgccttttctgctcattctggatgccaaaagctttacggaattg
gcccgtgcctctgttgatgtcgatatgcacatggatctccatggattattcattacagac
atggactgggacacaaaaaagcaggccgcttctgaggaacagcgggacagggcttccgac
tgccacggggctcctctgacctga

DBGET integrated database retrieval system