KEGG   Homo sapiens (human): 5367
Entry
5367              CDS       T01001                                 

Gene name
PMCH, MCH, ppMCH
Definition
(RefSeq) pro-melanin concentrating hormone
  KO
K05229  pro-melanin-concentrating hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5367 (PMCH)
SSDB
Motif
Pfam: Pro-MCH
Other DBs
NCBI-GeneID: 5367
NCBI-ProteinID: NP_002665
OMIM: 176795
HGNC: 9109
Ensembl: ENSG00000183395
Vega: OTTHUMG00000170479
Pharos: P20382(Tbio)
CPD: C16030 C16031 C16104
UniProt: P20382
LinkDB
Position
12q23.2
AA seq 165 aa
MAKMNLSSYILILTFSLFSQGILLSASKSIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIA
PSLEQYKNDESSFMNEEENKVSKNTGSKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGV
QNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcaaaaatgaatctctcttcctatatattaatactaactttttctttgttttctcaa
ggtattttactttcagcatccaagtccataagaaatttagatgatgacatggtatttaat
acattcaggttggggaaaggctttcagaaggaagacactgcagaaaaatcagttattgct
ccttccctggaacaatataaaaatgatgagagcagtttcatgaacgaagaggaaaataaa
gtttcaaagaacacaggctccaaacataatttcttaaatcatggtctgccactgaatctg
gctataaaaccttatcttgcactaaaaggatctgtagctttcccagctgagaatggagtt
cagaatactgaatcaacacaagaaaagagagaaattggggatgaagaaaactcagctaaa
tttcctataggaaggagagattttgacatgctcagatgtatgctgggaagagtctaccga
ccttgttggcaagtctga

DBGET integrated database retrieval system