KEGG   Homo sapiens (human): 537Help
Entry
537               CDS       T01001                                 

Gene name
ATP6AP1, 16A, ATP6IP1, ATP6S1, Ac45, CF2, VATPS1, XAP-3, XAP3
Definition
(RefSeq) ATPase H+ transporting accessory protein 1
  KO
K03662  V-type H+-transporting ATPase S1 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05165  Human papillomavirus infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    537 (ATP6AP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    537 (ATP6AP1)
   04142 Lysosome
    537 (ATP6AP1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    537 (ATP6AP1)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    537 (ATP6AP1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    537 (ATP6AP1)
   05152 Tuberculosis
    537 (ATP6AP1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    537 (ATP6AP1)
   05165 Human papillomavirus infection
    537 (ATP6AP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_S1
Motif
Other DBs
NCBI-GeneID: 537
NCBI-ProteinID: NP_001174
OMIM: 300197
HGNC: 868
Ensembl: ENSG00000071553
Vega: OTTHUMG00000033291
Pharos: Q15904(Tchem)
UniProt: Q15904 A0A384MQW4
LinkDB All DBs
Position
Xq28
AA seq 470 aa AA seqDB search
MMAAMATARVRMGPRCAQALWRMPWLPVFLSLAAAAAAAAAEQQVPLVLWSSDRDLWAPA
ADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNL
ENALDLAPSSLVLPAVDWYAVSTLTTYLQEKLGASPLHVDLATLRELKLNASLPALLLIR
LPYTASSGLMAPREVLTGNDEVIGQVLSTLKSEDVPYTAALTAVRPSRVARDVAVVAGGL
GRQLLQKQPVSPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS
FWNDSFARLSLTYERLFGTTVTFKFILANRLYPVSARHWFTMERLEVHSNGSVAYFNASQ
VTGPSIYSFHCEYVSSLSKKGSLLVARTQPSPWQMMLQDFQIQAFNVMGEQFSYASDCAS
FFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFDDHKGPTISLTQIV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggccatggcgacggctcgagtgcggatggggccgcggtgcgcccaggcgctc
tggcgcatgccgtggctgccggtgtttttgtcgttggcggcggcggcggcggcggcagcg
gcggagcagcaggtcccgctggtgctgtggtcgagtgaccgggacttgtgggctcctgcg
gccgacactcatgaaggccacatcaccagcgacttgcagctctctacctacttagatccc
gccctggagctgggtcccaggaatgtgctgctgttcctgcaggacaagctgagcattgag
gatttcacagcatatggcggtgtgtttggaaacaagcaggacagcgccttttctaaccta
gagaatgccctggacctggccccctcctcactggtgcttcctgccgtcgactggtatgca
gtcagcactctgaccacttacctgcaggagaagctcggggccagccccttgcatgtggac
ctggccaccctgcgggagctgaagctcaatgccagcctccctgctctgctgctcattcgc
ctgccctacacagccagctctggtctgatggcacccagggaagtcctcacaggcaacgat
gaggtcatcgggcaggtcctgagcacactcaagtccgaagatgtcccatacacagcggcc
ctcacagcggtccgcccttccagggtggcccgtgatgtagccgtggtggccggagggcta
ggtcgccagctgctacaaaaacagccagtatcacctgtgatccatcctcctgtgagttac
aatgacaccgctccccggatcctgttctgggcccaaaacttctctgtggcgtacaaggac
cagtgggaggacctgactcccctcacctttggggtgcaggaactcaacctgactggctcc
ttctggaatgactcctttgccaggctctcactgacctatgaacgactctttggtaccaca
gtgacattcaagttcattctggccaaccgcctctacccagtgtctgcccggcactggttt
accatggagcgcctcgaagtccacagcaatggctccgtcgcctacttcaatgcttcccag
gtcacagggcccagcatctactccttccactgcgagtatgtcagcagcctgagcaagaag
ggtagtctcctcgtggcccgcacgcagccctctccctggcagatgatgcttcaggacttc
cagatccaggctttcaacgtaatgggggagcagttctcctacgccagcgactgtgccagc
ttcttctcccccggcatctggatggggctgctcacctccctgttcatgctcttcatcttc
acctatggcctgcacatgatcctcagcctcaagaccatggatcgctttgatgaccacaag
ggccccactatttctttgacccagattgtgtga

DBGET integrated database retrieval system