KEGG   Homo sapiens (human): 53832
Entry
53832             CDS       T01001                                 

Gene name
IL20RA, CRF2-8, IL-20R-alpha, IL-20R1, IL-20RA
Definition
(RefSeq) interleukin 20 receptor subunit alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04630  JAK-STAT signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01271  IL19/20/24 to IL20R signaling
N01272  YLDV 134R to IL20R signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    53832 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    53832 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    53832 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    53832 (IL20RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL10/28 receptor family
   53832 (IL20RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 53832
NCBI-ProteinID: NP_055247
OMIM: 605620
HGNC: 6003
Ensembl: ENSG00000016402
Vega: OTTHUMG00000015654
Pharos: Q9UHF4(Tbio)
UniProt: Q9UHF4
LinkDB
Structure
PDB: 
4DOH

Position
6q23.3
AA seq 553 aa
MRAPGRPALRPLPLPPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWTPPE
GLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKC
SKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLK
YNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTL
KDQSSEFKAKIIFWYVLPISITVFLFSVMGYSIYRYIHVGKEKHPANLILIYGNEFDKRF
FVPAEKIVINFITLNISDDSKISHQDMSLLGKSSDVSSLNDPQPSGNLRPPQEEEEVKHL
GYASHLMEIFCDSEENTEGTSLTQQESLSRTIPPDKTVIEYEYDVRTTDICAGPEEQELS
LQEEVSTQGTLLESQAALAVLGPQTLQYSYTPQLQDLDPLAQEHTDSEEGPEEEPSTTLV
DWDPQTGRLCIPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEPAPDRPPGENETYLMQ
FMEEWGLYVQMEN
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgcgggctcccggccgcccggccctgcggccgctgccgctgccgccgctgctgctgttg
ctcctggcggcgccttggggacgggcagttccctgtgtctctggtggtttgcctaaacct
gcaaacatcaccttcttatccatcaacatgaagaatgtcctacaatggactccaccagag
ggtcttcaaggagttaaagttacttacactgtgcagtatttcatatatgggcaaaagaaa
tggctgaataaatcagaatgcagaaatatcaatagaacctactgtgatctttctgctgaa
acttctgactacgaacaccagtattatgccaaagttaaggccatttggggaacaaagtgt
tccaaatgggctgaaagtggacggttctatccttttttagaaacacaaattggcccacca
gaggtggcactgactacagatgagaagtccatttctgttgtcctgacagctccagagaag
tggaagagaaatccagaagaccttcctgtttccatgcaacaaatatactccaatctgaag
tataacgtgtctgtgttgaatactaaatcaaacagaacgtggtcccagtgtgtgaccaac
cacacgctggtgctcacctggctggagccgaacactctttactgcgtacacgtggagtcc
ttcgtcccagggccccctcgccgtgctcagccttctgagaagcagtgtgccaggactttg
aaagatcaatcatcagagttcaaggctaaaatcatcttctggtatgttttgcccatatct
attaccgtgtttcttttttctgtgatgggctattccatctaccgatatatccacgttggc
aaagagaaacacccagcaaatttgattttgatttatggaaatgaatttgacaaaagattc
tttgtgcctgctgaaaaaatcgtgattaactttatcaccctcaatatctcggatgattct
aaaatttctcatcaggatatgagtttactgggaaaaagcagtgatgtatccagccttaat
gatcctcagcccagcgggaacctgaggccccctcaggaggaagaggaggtgaaacattta
gggtatgcttcgcatttgatggaaattttttgtgactctgaagaaaacacggaaggtact
tctctcacccagcaagagtccctcagcagaacaatacccccggataaaacagtcattgaa
tatgaatatgatgtcagaaccactgacatttgtgcggggcctgaagagcaggagctcagt
ttgcaggaggaggtgtccacacaaggaacattattggagtcgcaggcagcgttggcagtc
ttgggcccgcaaacgttacagtactcatacacccctcagctccaagacttagaccccctg
gcgcaggagcacacagactcggaggaggggccggaggaagagccatcgacgaccctggtc
gactgggatccccaaactggcaggctgtgtattccttcgctgtccagcttcgaccaggat
tcagagggctgcgagccttctgagggggatgggctcggagaggagggtcttctatctaga
ctctatgaggagccggctccagacaggccaccaggagaaaatgaaacctatctcatgcaa
ttcatggaggaatgggggttatatgtgcagatggaaaactga

DBGET integrated database retrieval system