KEGG   Homo sapiens (human): 53919Help
Entry
53919             CDS       T01001                                 

Gene name
SLCO1C1, OATP-F, OATP1, OATP14, OATP1C1, OATPF, OATPRP5, SLC21A14
Definition
(RefSeq) solute carrier organic anion transporter family member 1C1
  KO
K08747  solute carrier organic anion transporter family, member 1C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    53919 (SLCO1C1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    53919 (SLCO1C1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC21/ASLCO: Organic anion transporter
   53919 (SLCO1C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1
Motif
Other DBs
NCBI-GeneID: 53919
NCBI-ProteinID: NP_059131
OMIM: 613389
HGNC: 13819
Ensembl: ENSG00000139155
Vega: OTTHUMG00000168966
Pharos: Q9NYB5(Tbio)
UniProt: Q9NYB5
LinkDB All DBs
Position
12p12.2
AA seq 712 aa AA seqDB search
MDTSSKENIQLFCKTSVQPVGRPSFKTEYPSSEEKQPCCGELKVFLCALSFVYFAKALAE
GYLKSTITQIERRFDIPSSLVGVIDGSFEIGNLLVITFVSYFGAKLHRPKIIGAGCVIMG
VGTLLIAMPQFFMEQYKYERYSPSSNSTLSISPCLLESSSQLPVSVMEKSKSKISNECEV
DTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQTVAIIGPIFGF
LLGSLCAKLYVDIGFVNLDHITITPKDPQWVGAWWLGYLIAGIISLLAAVPFWYLPKSLP
RSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLFGNPVYFLYLC
TSTVQFNSLFGMVTYKPKYIEQQYGQSSSRANFVIGLINIPAVALGIFSGGIVMKKFRIS
VCGAAKLYLGSSVFGYLLFLSLFALGCENSDVAGLTVSYQGTKPVSYHERALFSDCNSRC
KCSETKWEPMCGENGITYVSACLAGCQTSNRSGKNIIFYNCTCVGIAASKSGNSSGIVGR
CQKDNGCPQMFLYFLVISVITSYTLSLGGIPGYILLLRCIKPQLKSFALGIYTLAIRVLA
GIPAPVYFGVLIDTSCLKWGFKRCGSRGSCRLYDSNVFRHIYLGLTVILGTVSILLSIAV
LFILKKNYVSKHRSFITKRERTMVSTRFQKENYTTSDHLLQPNYWPGKETQL
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggacacttcatccaaagaaaatatccagttgttctgcaaaacttcagtgcaacctgtt
ggaaggccttcttttaaaacagaatatccctcctcagaagaaaagcaaccatgctgtggt
gaactaaaggtgttcttgtgtgccttgtcttttgtttactttgccaaagcattggcagaa
ggctatctgaagagcaccatcactcagatagagagaaggtttgatatcccttcttcactg
gtgggagttattgatggtagttttgaaattgggaatctcttagttataacatttgttagc
tactttggagccaaacttcacaggccaaaaataattggagcagggtgtgtaatcatggga
gttggaacactgctcattgcaatgcctcagttcttcatggagcagtacaaatatgagaga
tattctccttcctccaattccactctcagcatctctccgtgtctcctagagtcaagcagt
caattaccagtttcagttatggaaaaatcaaaatccaaaataagtaacgaatgtgaagtg
gacactagctcttccatgtggatttatgttttcctgggcaatcttcttcgtggaatagga
gaaactcccattcagcctttgggcattgcctacctggatgattttgccagtgaagacaat
gcagctttctatattgggtgtgtgcagacggttgcaattataggaccaatctttggtttc
ctgttaggctcattatgtgccaaactatatgttgacattggctttgtaaacctagatcac
ataaccattaccccaaaagatccccagtgggtaggagcctggtggcttggctatctaata
gcaggaatcataagtcttcttgcagctgtgcctttctggtatttaccaaagagtttacca
agatcccaaagtagagaggattctaattcttcctctgagaaatccaagtttattatagat
gatcacacagactaccaaacaccccagggagaaaatgcaaaaataatggaaatggcaaga
gattttcttccatcactgaagaatctttttggaaacccagtatacttcctatatttatgt
acaagcactgttcagttcaattctctgttcggcatggtgacgtacaaaccaaagtacatt
gagcagcagtatggacagtcatcctccagggccaactttgtgatcgggctcatcaacatt
ccagcagtggcccttggaatattctctggggggatagttatgaaaaaattcagaatcagt
gtgtgtggagctgcaaaactctacttgggatcatctgtctttggttacctcctatttctt
tccctgtttgcactgggctgtgaaaattctgatgtggcaggactaactgtctcctaccaa
ggaaccaaacctgtctcttatcatgaacgagctctcttttcagattgcaactcaagatgc
aaatgttcagagacaaaatgggaacccatgtgcggtgaaaatggaatcacatatgtatca
gcttgtcttgctggttgtcaaacctccaacaggagtggaaaaaatattatattttacaac
tgcacttgtgtgggaattgcagcttctaaatccggaaattcctcaggcatagtgggaaga
tgtcagaaagacaatggatgtccccaaatgtttctgtatttccttgtaatttcagtcatc
acatcctatactttatccctaggtggcatacctggatacatattacttctgaggtgcatt
aagccacagcttaagtcttttgccttgggtatctacacattagcaataagagttcttgca
ggaatcccagctccagtgtattttggagttttgattgatacttcatgcctcaaatgggga
tttaaaagatgtggaagtagaggatcatgcagattatatgattcaaatgtcttcagacat
atatatctgggactaactgtgatactgggcacagtgtcaattctcctaagcattgcagta
cttttcattttaaagaaaaattatgtttcaaaacacagaagttttataaccaagagagaa
agaacaatggtgtctacaagattccaaaaggaaaattacactacaagtgatcatctgcta
caacccaactactggccaggcaaggaaactcaactttag

DBGET integrated database retrieval system