KEGG   Homo sapiens (human): 5408Help
Entry
5408              CDS       T01001                                 

Gene name
PNLIPRP2, PLRP2
Definition
(RefSeq) pancreatic lipase related protein 2 (gene/pseudogene)
  KO
K14075  pancreatic lipase-related protein 2 [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Drug target
Orlistat: D04028
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    5408 (PNLIPRP2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5408 (PNLIPRP2)
   04975 Fat digestion and absorption
    5408 (PNLIPRP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     5408 (PNLIPRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_6 Retrotran_gag_3 Abhydrolase_3 Abhydrolase_1 DUF900
Motif
Other DBs
NCBI-GeneID: 5408
NCBI-ProteinID: NP_005387
OMIM: 604423
HGNC: 9157
Ensembl: ENSG00000266200
Vega: OTTHUMG00000181599
Pharos: P54317(Tbio)
UniProt: P54317
LinkDB All DBs
Structure
PDB: 

Position
10q25.3
AA seq 469 aa AA seqDB search
MLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYT
NENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNC
ICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEA
GRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKV
GHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFL
GYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYK
VSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKF
LWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccccttggaccctcggccttctcctgctggccacagtcagaggaaaagaggtc
tgctacggacaacttggctgcttttctgatgaaaaaccatgggcaggaacccttcagcga
cctgtaaaattacttccctggtcccccgaggacattgacacccgctttcttctgtacaca
aatgaaaatccaaacaacttccaactaatcactggcacggaaccagacaccattgaggct
tcaaacttccaactggaccgcaagacacgcttcatcatccatggcttcttagacaaggcg
gaggacagctggccatcggacatgtgcaagaaaatgtttgaagtggagaaggtgaactgc
atctgtgtggactggaggcacgggtcccgggcaatgtacacccaagccgtgcaaaacatt
cgggttgttggggcggagacagctttcttaatacaagcactgtcgacgcagctagggtac
agccttgaggacgtgcatgtcatcggccacagcctgggcgcgcacacggccgcggaggcg
ggcaggaggctggggggccgcgtgggcaggatcacagggctggatccagcagggccgtgc
ttccaggatgaacctgaggaggttcggttggatccatctgacgccgtgtttgtggatgtg
attcacacagattcttctcccatagttccttccctaggtttcggaatgagccaaaaggtg
ggccatctggatttctttccaaatggaggaaaggaaatgcccggatgtaagaaaaatgtc
ctttcaaccattactgatattgatggaatatgggaaggaattggtggctttgtgtcttgc
aatcacctaagaagcttcgagtattactcaagcagcgtcctcaaccctgatggcttcctg
ggctatccctgtgcctcctacgatgagtttcaggagagtaagtgtttcccttgtccagct
gaaggatgccccaaaatggggcactatgctgaccaatttaaggggaaaacaagtgctgtg
gaacaaacctttttcctgaacacaggagagagtggtaactttactagttggagatataag
gtatcagtcacactttctggaaaagagaaagtgaatgggtacatcaggattgctttgtat
ggaagtaatgaaaactcaaaacaatatgagattttcaaaggatccctcaaaccagatgca
agtcacacgtgtgctattgatgtggattttaatgttggaaaaatacagaaagttaaattc
ctctggaacaaacgtgggataaatctatctgagcccaaactgggggcttcccaaatcaca
gtgcaaagtggtgaagatgggactgagtataatttttgtagcagcgacactgtggaagaa
aacgtcttgcaatctctttacccttgttaa

DBGET integrated database retrieval system