KEGG   Homo sapiens (human): 54212
Entry
54212             CDS       T01001                                 

Gene name
SNTG1, G1SYN, SYN4
Definition
(RefSeq) syntrophin gamma 1
  KO
K24065  gamma-syntrophin
Organism
hsa  Homo sapiens (human)
Network
  Element
N00465  Deleted DMD to dystrophin-associated protein complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    54212 (SNTG1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   54212 (SNTG1)
SSDB
Motif
Pfam: PDZ PDZ_6 Tricorn_PDZ
Other DBs
NCBI-GeneID: 54212
NCBI-ProteinID: NP_001274742
OMIM: 608714
HGNC: 13740
Ensembl: ENSG00000147481
Vega: OTTHUMG00000164257
Pharos: Q9NSN8(Tbio)
UniProt: Q9NSN8 A0A024R7Y0 B2RA84
LinkDB
Position
8q11.21
AA seq 517 aa
MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTI
RRQTVGGFGLSIKGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQINGINVRKCRHEE
VVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRFSQYVPGTDLSRQNAFQVIAVDGVC
TGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQD
RVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDLLDRRKQCFTV
QSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF
ICFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIH
SFFAAKVACLDPLFLGNQATASTAASSATTSKAKYTT
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggatttcagaaccgcctgtgaggagacaaagacaggaatttgtttgctgcaggatggt
aaccaggagcctttcaaagtgcggctgcacctagccaaagacattttgatgatccaggaa
caggatgtgatatgtgtgtctggtgagcctttctattctggtgaaagaacggtgaccatc
agaagacaaacagtaggaggatttggattaagcataaagggaggagcagaacataacatt
ccagttgtcgtttcaaaaatctccaaggaacaaagagcggaactttcaggactacttttt
attggagatgcaattctacagataaatggcattaatgtgagaaaatgtagacatgaagaa
gtggttcaggttcttcggaatgctggagaagaagtgactctaacagtgtcatttttaaaa
agagcacctgctttcctcaaactcccattgaatgaagattgtgcatgtgctccaagtgac
cagagcagtggcacctcctctcctctctgtgacagtggcttacatctcaactaccatccc
aacaatacagacacattatcatgctcgtcgtggccgacgtctccaggcttgaggtgggag
aagcgatggtgcgacctcagactgatccctctacttcattcgcgcttctctcagtatgtg
cccggcacagatttgagtcggcagaatgcctttcaagtcattgctgtggatggggtctgc
actgggattattcagtgcctctctgctgaagactgcgttgactggctacaagcaatagca
actaacatttcaaatctcacaaagcacaatattaaaaaaatcaacagaaactttcctgta
aaccagcagattgtctacatgggctggtgtgaagcccgggagcaagaccccctccaggac
agagtgtactccccgaccttcctggccctgaggggctcatgtctctacaagtttctggca
cctccagtgaccacctgggactggacgagagcagagaaaacattctcagtttatgagatt
atgtgcaagatcctcaaggacagtgacctgctggaccgacggaaacagtgcttcaccgtg
cagtctgagtctggggaggacctgtacttctcagtggagctggaaagtgacctcgcccag
tgggaaagagccttccagacagcaacctttctagaagtagaacggatacagtgcaagacc
tatgcatgtgtgctagaaagtcatctaatgggactcacaattgatttcagcacaggattt
atctgctttgatgctgcaacaaaggctgtcctttggaggtataaattctctcagcttaaa
ggttcttcagatgatggcaagagcaaaatcaaatttttgtttcagaatccagatactaaa
cagattgaagcaaaggagttggaattttctaatttatttgctgttcttcactgcattcat
tccttctttgctgccaaggtagcttgtttggaccctctatttttaggcaatcaagctact
gcttctactgctgccagctctgctaccacgagcaaagcaaagtatacaacttga

DBGET integrated database retrieval system