KEGG   Homo sapiens (human): 5422Help
Entry
5422              CDS       T01001                                 

Gene name
POLA1, NSX, POLA, p180
Definition
(RefSeq) DNA polymerase alpha 1, catalytic subunit
  KO
K02320  DNA polymerase alpha subunit A [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
Module
hsa_M00261  DNA polymerase alpha / primase complex
Drug target
Clofarabine: D03546
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5422 (POLA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5422 (POLA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     5422 (POLA1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    5422 (POLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-DNA_Pol DNA_pol_alpha_N DUF1744 DNA_pol_B_2 rRNA_proc-arch
Motif
Other DBs
NCBI-GeneID: 5422
NCBI-ProteinID: NP_058633
OMIM: 312040
HGNC: 9173
Ensembl: ENSG00000101868
Vega: OTTHUMG00000021277
Pharos: P09884(Tclin)
UniProt: P09884
LinkDB All DBs
Structure
PDB: 

Position
Xp22.11-p21.3
AA seq 1462 aa AA seqDB search
MAPVHGDDSLSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTGVYEE
VDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDK
RNVKKLAVTKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMI
LKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPVPLKRAEFAGDDVQVESTEE
EQESGAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSF
LPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVF
LFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEK
IATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTN
TSSLELFLMNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVM
AFSMKTMQNAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKE
VIEKKNVKVEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWS
KIGRLKRSNMPKLGGRSGFGERNATCGRMICDVEISAKELIRCKSYHLSELVQQILKTER
VVIPMENIQNMYSESSQLLYLLEHTWKDAKFILQIMCELNVLPLALQITNIAGNIMSRTL
MGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKAAYA
GGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVASEAQKVTEDGEQEQIPE
LPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCL
GFSYSRFYAKPLAALVTYKGREILMHTKEMVQKMNLEVIYGDTDSIMINTNSTNLEEVFK
LGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVEPTSDGNYVTKQELKGLDIV
RRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALT
KDPQDYPDKKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTASQRAYAPEQLQK
QDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDAL
LGGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPL
TFTVQLSNKLIMDIRRFIKKYYDGWLICEEPTCRNRTRHLPLQFSRTGPLCPACMKATLQ
PEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQF
LSRSGYSEVNLSKLFAGCAVKS
NT seq 4389 nt NT seq  +upstreamnt  +downstreamnt
atggcacctgtgcacggcgacgactctctgtcagattcagggagttttgtatcttctcga
gcccggcgagaaaaaaaatcaaagaaggggcgccaagaagccctagaaagactgaaaaag
gctaaagctggtgagaagtataaatatgaagtcgaggacttcacaggtgtttatgaagaa
gttgatgaagaacagtattcgaagctggttcaggcacgccaggatgatgactggattgtg
gatgatgatggtattggctatgtggaagatggccgagagatttttgatgatgaccttgaa
gatgatgcccttgatgctgatgagaaaggaaaagatggtaaagcacgcaataaagacaag
aggaatgtaaagaagctcgcagtgacaaaaccgaacaacattaagtcaatgttcattgct
tgtgctggaaagaaaactgcagataaagctgtagacttgtccaaggatggtctgctaggt
gacattctacaggatcttaacactgagacacctcaaataactccaccacctgtaatgata
ctgaagaagaaaagatccattggagcttcaccgaatcctttctctgtgcacaccgccacg
gcagttccttcaggaaaaattgcttcccctgtctccagaaaggagcctccattaactcct
gttcctcttaaacgtgctgaatttgctggcgatgatgtacaggtcgagagtacagaagaa
gagcaggagtcaggggcaatggagtttgaagatggtgactttgatgagcccatggaagtt
gaagaggtggacctggagcctatggctgccaaggcttgggacaaagagagtgagccagca
gaggaagtgaaacaagaggcggattctgggaaagggaccgtgtcctacttaggaagtttt
ctcccggatgtctcttgttgggacattgatcaagaaggtgatagcagtttctcagtgcaa
gaagttcaagtggattccagtcacctcccattggtaaaaggggcagatgaggaacaagta
ttccacttttattggttggatgcttatgaggatcagtacaaccaaccaggtgtggtattt
ctgtttgggaaagtttggattgaatcagccgagacccatgtgagctgttgtgtcatggtg
aaaaatatcgagcgaacgctttacttccttccccgtgaaatgaaaattgatctaaatacg
gggaaagaaacaggaactccaatttcaatgaaggatgtttatgaggaatttgatgagaaa
atagcaacaaaatataaaattatgaagttcaagtctaagccagtggaaaagaactatgct
tttgagatacctgatgttccagaaaaatctgagtacttggaagttaaatactcggctgaa
atgccacagcttcctcaagatttgaaaggagaaactttttctcatgtatttgggaccaac
acatctagcctggaactgttcttgatgaacagaaagatcaaaggaccttgttggcttgaa
gtaaaaagtccacagctcttgaatcagccagtcagttggtgtaaagttgaggcaatggct
ttgaaaccagacctggtgaatgtaattaaggatgtcagtccaccaccgcttgtcgtgatg
gctttcagcatgaagacaatgcagaatgcaaagaaccatcaaaatgagattattgctatg
gcagctttggtccatcacagttttgcattggataaagcagccccaaagcctccctttcag
tcacacttctgtgttgtgtctaaaccaaaggactgtatttttccatatgctttcaaagaa
gtcattgagaaaaagaatgtgaaggttgaggttgctgcaacagaaagaacactgctaggt
tttttccttgcaaaagttcacaaaattgatcctgatatcattgtgggtcataatatttat
gggtttgaactggaagtactactgcagagaattaatgtgtgcaaagctcctcactggtcc
aagataggtcgactgaagcgatccaacatgccaaagcttgggggccggagtggatttggt
gaaagaaatgctacctgtggtcgaatgatctgtgatgtggaaatttcagcaaaggaattg
attcgttgtaaaagctaccatctgtctgaacttgttcagcagattctaaaaactgaaagg
gttgtaatcccaatggaaaatatacaaaatatgtacagtgaatcttctcaactgttatac
ctgttggaacacacctggaaagatgccaagttcattttgcagatcatgtgtgagctaaat
gttcttccattagcattgcagatcactaacatcgctgggaacattatgtccaggacgctg
atgggtggacgatccgagcgtaacgagttcttgttgcttcatgcattttacgaaaacaac
tatattgtgcctgacaagcagattttcagaaagcctcagcaaaaactgggagatgaagat
gaagaaattgatggagataccaataaatacaagaaaggacgtaagaaagcagcttatgct
ggaggcttggttttggaccccaaagttggtttttatgataagttcattttgcttctggac
ttcaacagtctatatccttccatcattcaggaatttaacatttgttttacaacagtacaa
agagttgcttcagaggcacagaaagttacagaggatggagaacaagaacagatccctgag
ttgccagatccaagcttagaaatgggcattttgcccagagagatccggaaactggtagaa
cggagaaaacaagtcaaacagctaatgaaacagcaagacttaaatccagaccttattctt
cagtatgacattcgacagaaggctttgaagctcacagcgaacagtatgtatggttgcctg
ggattttcctatagcagattttacgccaaaccactggctgccttggtgacatacaaagga
agggagattttgatgcatacgaaagagatggtacaaaagatgaatcttgaagttatttat
ggagatacagattcaattatgataaacaccaatagcaccaatctggaagaagtatttaag
ttgggaaacaaggtaaaaagtgaagtgaataagttgtacaaactgcttgaaatagacatt
gatggggttttcaagtctctgctactgctgaaaaaaaagaagtacgctgctctggttgtt
gagccaacgtcggatgggaattatgtcaccaaacaggagctcaaaggattagatatagtt
agaagagattggtgtgatcttgctaaagacactggaaactttgtgattggccagattctt
tctgatcaaagccgggacactatagtggaaaacattcagaagaggctgatagaaattgga
gaaaatgtgctaaatggcagtgtcccagtgagccagtttgaaattaacaaggcattgaca
aaggatccccaggattaccctgataaaaaaagcctacctcatgtacatgttgccctctgg
ataaattctcaaggaggcagaaaggtgaaagctggagatactgtgtcatatgtcatctgt
caggatggatcaaacctcactgcaagtcagagggcctatgcgcctgagcagctgcagaaa
caggataatctaaccattgacacccagtactacctggcccagcagatccacccagtcgtg
gctcggatctgtgaaccaatagacggaattgatgctgtcctcattgcaacgtggttggga
cttgaccccacccaatttagagttcatcattatcataaagatgaagagaatgatgctcta
cttggtggcccagcacagctcactgatgaagagaaatacagggactgtgaaagattcaaa
tgtccatgccctacatgtggaactgagaatatttatgataatgtctttgatggttcggga
acagatatggagcccagcttgtatcgttgcagtaacatcgattgtaaggcttcacctctg
acctttacagtacaactgagcaacaaattgatcatggacattagacgtttcattaaaaag
tactatgatggctggttgatatgtgaagagccaacctgtcgcaatcgaactcgtcacctt
ccccttcaattctcccgaactgggcctctttgcccagcctgcatgaaagctacacttcaa
ccagagtattctgacaagtccctgtacacccagctgtgcttttaccggtacatttttgat
gcggagtgtgcactggagaaacttactaccgatcatgagaaagataaattgaagaagcaa
ttttttacccccaaagttctgcaggactacagaaaactcaagaacacagcagagcaattc
ttgtcccgaagtggctactccgaagtgaatctgagcaaactcttcgctggttgtgccgtg
aaatcctaa

DBGET integrated database retrieval system