KEGG   Homo sapiens (human): 54221
Entry
54221             CDS       T01001                                 

Gene name
SNTG2, G2SYN, SYN5
Definition
(RefSeq) syntrophin gamma 2
  KO
K24065  gamma-syntrophin
Organism
hsa  Homo sapiens (human)
Network
  Element
N00465  Deleted DMD to dystrophin-associated protein complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    54221 (SNTG2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   54221 (SNTG2)
SSDB
Motif
Pfam: PDZ PDZ_6 PH PDZ_2 PH_17 Tricorn_PDZ
Other DBs
NCBI-GeneID: 54221
NCBI-ProteinID: NP_061841
OMIM: 608715
HGNC: 13741
Ensembl: ENSG00000172554
Vega: OTTHUMG00000151370
Pharos: Q9NY99(Tbio)
UniProt: Q9NY99
LinkDB
Position
2p25.3
AA seq 539 aa
MGTEGPPPPAASRGRQGCLLVPARTKTTIALLYDEESENAYDIRLKLTKEVLTIQKQDVV
CVGGSHQGRNRRTVTLRRQPVGGLGLSIKGGSEHNVPVVISKIFEDQAADQTGMLFVGDA
VLQVNGIHVENATHEEVVHLLRNAGDEVTITVEYLREAPAFLKLPLGSPGPSSDHSSGAS
SPLFDSGLHLNGNSSTTAPSSPSSPIAKDPRYEKRWLDTLSVPLSMARISRYKAGTEKLR
WNAFEVLALDGVSSGILRFYTAQDGTDWLRAVSANIRELTLQNMKMANKCCSPSDQVVHM
GWVNEKLQGADSSQTFRPKFLALKGPSFYVFSTPPVSTFDWVRAERTYHLCEVLFKVHKF
WLTEDCWLQANLYLGLQDFDFEDQRPYCFSIVAGHGKSHVFNVELGSELAMWEKSFQRAT
FMEVQRTGSRTYMCSWQGEMLCFTVDFALGFTCFESKTKNVLWRFKFSQLKGSSDDGKTR
VKLLFQNLDTKQIETKELEFQDLRAVLHCIHSFIAAKVASVDPGFMDSQSLARKYMYSS
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgggcaccgagggacccccgcccccggccgcctcccgcggacgccagggctgcctgctg
gtacctgcgcggacgaaaaccactattgctctgttgtatgatgaagagtccgaaaatgcc
tatgacatccggctgaagctgacgaaagaggtgctgacaattcagaaacaagatgttgtc
tgtgtgggcggaagccaccagggcaggaatcgcagaactgttacactccgcagacagcca
gttggcggcttgggcctgagtataaagggaggttctgagcacaacgtccctgtcgtcata
tcaaaaatattcgaagaccaagcagctgaccagacagggatgttgttcgtaggagatgct
gttctccaggttaatggcatacatgtagaaaatgcaactcatgaagaagtggtgcatctg
ctgagaaatgctggcgatgaagttaccatcaccgttgagtatctcagggaagcgccggca
tttctgaagctcccgttagggtccccagggccatccagcgaccacagcagtggggcctcc
tctcccctctttgacagcggtttgcatctgaacggaaactccagtaccacagccccatcg
tcaccttcctcgcccatagctaaggacccgaggtatgagaagcgctggctggacaccttg
tccgtgcctctgtccatggctcgcatctcaaggtacaaagccggaacggaaaaattaagg
tggaatgcgttcgaggtgctcgccctggacggagtcagctctgggatcctccggttttac
acagcccaggatggcaccgactggctgcgggcggtctcagccaacatcagggagctgaca
cttcagaacatgaagatggcgaacaaatgctgctctccttccgaccaggttgtgcatatg
gggtgggtaaatgagaaactccaaggagctgactcctctcaaaccttcagacccaagttc
ctagcactgaagggcccgtccttctacgttttcagcactcctccggtgagcacattcgat
tgggtgcgagcagaaaggacctatcacctctgtgaggtgctatttaaagttcacaagttc
tggctcacagaggactgctggttgcaagcaaacttgtatctgggtcttcaagattttgac
tttgaggaccagaggccctattgcttcagcatcgtggccggccatgggaagagccatgtt
ttcaacgtggagcttggcagcgagctggccatgtgggagaagtccttccaaagagccacg
ttcatggaagttcagagaaccgggtccagaacatacatgtgcagctggcaaggagagatg
ctgtgtttcacggtggatttcgcgttgggatttacctgttttgagagtaagaccaagaat
gtgctctggagatttaaattttcccagcttaagggatcttcagatgatgggaaaactcga
gtaaagctgctgtttcagaatctggacaccaaacagattgagacgaaggaactcgagttc
caggacctgagggctgtcctgcactgcatccactccttcatagcagccaaggtggcctcc
gtggaccccggcttcatggacagtcagagtcttgccagaaaatacatgtacagcagctaa

DBGET integrated database retrieval system