KEGG   Homo sapiens (human): 54344Help
Entry
54344             CDS       T01001                                 

Gene name
DPM3, CDG1O
Definition
(RefSeq) dolichyl-phosphate mannosyltransferase subunit 3
  KO
K09659  dolichyl-phosphate mannosyltransferase polypeptide 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa01100  Metabolic pathways
Disease
H00118  Congenital disorders of glycosylation (CDG) type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    54344 (DPM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DPM3
Motif
Other DBs
NCBI-GeneID: 54344
NCBI-ProteinID: NP_714963
OMIM: 605951
HGNC: 3007
Ensembl: ENSG00000179085
Vega: OTTHUMG00000035335
Pharos: Q9P2X0(Tdark)
UniProt: Q9P2X0 Q86TM7
LinkDB All DBs
Position
1q22
AA seq 92 aa AA seqDB search
MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYR
VATFHDCEDAARELQSQIQEARADLARRGLRF
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaattagcgcagtggctttggggactagcgatcctgggctccacctgggtggcc
ctgaccacgggagccttgggcctggagctgcccttgtcctgccaggaagtcctgtggcca
ctgcccgcctacttgctggtgtccgccggctgctatgccctgggcactgtgggctatcgt
gtggccacttttcatgactgcgaggacgccgcacgcgagctgcagagccagatacaggag
gcccgagccgacttagcccgcagggggctgcgcttctga

DBGET integrated database retrieval system