KEGG   Homo sapiens (human): 54407
Entry
54407             CDS       T01001                                 

Gene name
SLC38A2, ATA2, PRO1068, SAT2, SNAT2
Definition
(RefSeq) solute carrier family 38 member 2
  KO
K14207  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04724  Glutamatergic synapse
hsa04727  GABAergic synapse
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    54407 (SLC38A2)
  09156 Nervous system
   04724 Glutamatergic synapse
    54407 (SLC38A2)
   04727 GABAergic synapse
    54407 (SLC38A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    54407 (SLC38A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   54407 (SLC38A2)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 54407
NCBI-ProteinID: NP_061849
OMIM: 605180
HGNC: 13448
Ensembl: ENSG00000134294
Vega: OTTHUMG00000169471
Pharos: Q96QD8(Tbio)
UniProt: Q96QD8 A0A024R0W3
LinkDB
Position
12q13.11
AA seq 506 aa
MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKK
KYETEFHPGTTSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVH
LLLKTANEGGSLLYEQLGYKAFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIQAL
TNIEDKTGLWYLNGNYLVLLVSLVVILPLSLFRNLGYLGYTSGLSLLCMVFFLIVVICKK
FQVPCPVEAALIINETINTTLTQPTALVPALSHNVTENDSCRPHYFIFNSQTVYAVPILI
FSFVCHPAVLPIYEELKDRSRRRMMNVSKISFFAMFLMYLLAALFGYLTFYEHVESELLH
TYSSILGTDILLLIVRLAVLMAVTLTVPVVIFPIRSSVTHLLCASKDFSWWRHSLITVSI
LAFTNLLVIFVPTIRDIFGFIGASAASMLIFILPSAFYIKLVKKEPMKSVQKIGALFFLL
SGVLVMTGSMALIVLDWVHNAPGGGH
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgaagaaggccgaaatgggacgattcagtatttccccggatgaagacagcagcagctac
agttccaacagcgacttcaactactcctaccccaccaagcaagctgctctgaaaagccat
tatgcagatgtagatcctgaaaaccagaactttttacttgaatcgaatttggggaagaag
aagtatgaaacagaatttcatccaggtactacttcctttggaatgtcagtatttaatctg
agcaatgcgattgtgggcagtggaatccttgggctttcttatgccatggctaatactgga
attgctctttttataattctcttgacatttgtgtcaatattttccctgtattctgttcat
ctccttttgaagactgccaatgaaggagggtctttattatatgaacaattgggatataag
gcatttggattagttggaaagcttgcagcatctggatcaattacaatgcagaacattgga
gctatgtcaagctacctcttcatagtgaaatatgagttgcctttggtgatccaggcatta
acgaacattgaagataaaactggattgtggtatctgaacgggaactatttggttctgttg
gtgtcattggtggtcattcttcctttgtcgctgtttagaaatttaggatatttgggatat
accagtggcctttccttgttgtgtatggtgttctttctgattgtggtcatttgcaagaaa
tttcaggttccgtgtcctgtggaagctgctttgataattaacgaaacaataaacaccacc
ttaacacagccaacagctcttgtacctgctttgtcacataacgtgactgaaaatgactct
tgcagacctcactattttattttcaactcacagactgtctatgctgtgccaattctgatc
ttttcatttgtctgtcatcctgctgttcttcccatctatgaagaactgaaagaccgcagc
cgtagaagaatgatgaatgtgtccaagatttcattttttgctatgtttctcatgtatctg
cttgccgccctctttggatacctaacattttacgaacatgttgagtcagaattgcttcat
acctactcttctatcttgggaactgatattcttcttctcattgtccgtctggctgtgtta
atggctgtgaccctgacagtaccagtagttattttcccaatccggagttctgtaactcac
ttgttgtgtgcatcaaaagatttcagttggtggcgtcatagtctcattacagtgtctatc
ttggcatttaccaatttacttgtcatctttgtcccaactattagggatatctttggtttt
attggtgcatctgcagcttctatgttgatttttattcttccttctgccttctatatcaag
ttggtgaagaaagaacctatgaaatctgtacaaaagattggggctttgttcttcctgtta
agtggtgtactggtgatgaccggaagcatggccttgattgttttggattgggtacacaat
gcacctggaggtggccattaa

KEGG   Homo sapiens (human): 81539
Entry
81539             CDS       T01001                                 

Gene name
SLC38A1, ATA1, NAT2, SAT1, SNAT1
Definition
(RefSeq) solute carrier family 38 member 1
  KO
K14990  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04724  Glutamatergic synapse
hsa04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    81539 (SLC38A1)
   04727 GABAergic synapse
    81539 (SLC38A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    81539 (SLC38A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   81539 (SLC38A1)
SSDB
Motif
Pfam: Aa_trans Cation_ATPase_C NADH-u_ox-rdase
Other DBs
NCBI-GeneID: 81539
NCBI-ProteinID: NP_001070952
OMIM: 608490
HGNC: 13447
Ensembl: ENSG00000111371
Vega: OTTHUMG00000169470
Pharos: Q9H2H9(Tbio)
UniProt: Q9H2H9 A0A024R124
LinkDB
Position
12q13.11
AA seq 487 aa
MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEK
KKCDEYIPGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSIN
LLLICSKETGCMVYEKLGEQVFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFL
MGKEETFSAWYVDGRVLVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKK
FQIPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSELK
DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDDILILTVRLAV
IVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHTVVTCILLVVINLLVIFIPSMKDIFGV
VGVTSANMLIFILPSSLYLKITDQDGDKGTQRIWAALFLGLGVLFSLVSIPLVIYDWACS
SSSDEGH
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgatgcatttcaaaagtggactcgaattaactgagttgcaaaacatgacagtgcccgag
gatgataacattagcaatgactccaatgatttcaccgaagtagaaaatggtcagataaat
agcaagtttatttctgatcgtgaaagtagaagaagtctcacaaacagccatttggaaaaa
aagaagtgtgatgagtatattccaggtacaacctccttaggcatgtctgtttttaaccta
agcaacgccattatgggcagtgggattttgggactcgcctttgccctggcaaacactgga
atcctactttttctggtacttttgacttcagtgacattgctgtctatatattcaataaac
ctcctattgatctgttcaaaagaaacaggctgcatggtgtatgaaaagctgggggaacaa
gtctttggcaccacagggaagttcgtaatctttggagccacctctctacagaacactgga
gcaatgctgagctacctcttcatcgtaaaaaatgaactaccctctgccataaagtttcta
atgggaaaggaagagacattttcagcctggtacgtggatggccgcgttctggtggtgata
gttacctttggcataattctccctctgtgtctcttgaagaacttagggtatcttggctat
actagtggattttccttgagctgtatggtttttttcctaattgtggttatttacaagaaa
tttcaaattccctgcattgttccagagctaaattcaacaataagtgctaattcaacaaat
gctgacacgtgtacgccaaaatatgttaccttcaattcaaagaccgtgtatgctttaccc
accattgcatttgcatttgtttgccacccgtcagtcctgccaatttacagtgagcttaaa
gaccgatcacagaaaaaaatgcagatggtttcaaacatctcctttttcgccatgtttgtt
atgtacttcttgactgccatttttggctacttgacattctatgacaacgtgcagtccgac
ctccttcacaaatatcagagtaaagatgacattctcatcctgacagtgcggctggctgtc
attgttgctgtgatcctcacagtgccggtgttatttttcacggttcgttcatctttattt
gaactggctaagaaaacaaagtttaatttatgtcgtcataccgtggttacctgcatactc
ttggttgttatcaacttgttggtgatcttcataccctccatgaaggatatttttggagtc
gtaggagttacatctgctaacatgcttattttcattcttccttcatctctttatttaaaa
atcacagaccaggatggagataaaggaactcaaagaatttgggctgcccttttcttgggc
ctgggggtgttgttctccttggtcagcattcccttggtcatctatgactgggcctgctca
tcgagtagtgacgaaggccactga

DBGET integrated database retrieval system