KEGG   Homo sapiens (human): 54434Help
Entry
54434             CDS       T01001                                 

Gene name
SSH1, SSH1L
Definition
(RefSeq) slingshot protein phosphatase 1
  KO
K05766  protein phosphatase slingshot [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    54434 (SSH1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    54434 (SSH1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    54434 (SSH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     54434 (SSH1)
    3.1.3.48  protein-tyrosine-phosphatase
     54434 (SSH1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Slingshots
    54434 (SSH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc DEK_C Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 54434
NCBI-ProteinID: NP_061857
OMIM: 606778
HGNC: 30579
Ensembl: ENSG00000084112
Vega: OTTHUMG00000169371
Pharos: Q8WYL5(Tbio)
UniProt: Q8WYL5
LinkDB All DBs
Position
12q24.11
AA seq 1049 aa AA seqDB search
MALVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLSLSESFFMVKGAALFLQQGSSPQG
QRSLQHPHKHAGDLPQHLQVMINLLRCEDRIKLAVRLESAWADRVRYMVVVYSSGRQDTE
ENILLGVDFSSKESKSCTIGMVLRLWSDTKIHLDGDGGFSVSTAGRMHIFKPVSVQAMWS
ALQVLHKACEVARRHNYFPGGVALIWATYYESCISSEQSCINEWNAMQDLESTRPDSPAL
FVDKPTEGERTERLIKAKLRSIMMSQDLENVTSKEIRNELEKQMNCNLKELKEFIDNEML
LILGQMDKPSLIFDHLYLGSEWNASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRV
YDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAY
NYVKQKRSITRPNAGFMRQLSEYEGILDASKQRHNKLWRQQTDSSLQQPVDDPAGPGDFL
PETPDGTPESQLPFLDDAAQPGLGPPLPCCFRRLSDPLLPSPEDETGSLVHLEDPEREAL
LEEAAPPAEVHRPARQPQQGSGLCEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLGAGR
WGQLPTQLDQNLLNSENLNNNSKRSCPNGMEDDAIFGILNKVKPSYKSCADCMYPTASGA
PEASRERCEDPNAPAICTQPAFLPHITSSPVAHLASRSRVPEKPASGPTEPPPFLPPAGS
RRADTSGPGAGAALEPPASLLEPSRETPKVLPKSLLLKNSHCDKNPPSTEVVIKEESSPK
KDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPA
PPSRDGPASRLEASIPEESQDPAALHELGPLVMPSQAGSDEKSEAAPASLEGGSLKSPPP
FFYRLDHTSSFSKDFLKTICYTPTSSSMSSNLTRSSSSDSIHSVRGKPGLVKQRTQEIET
RLRLAGLTVSSPLKRSHSLAKLGSLTFSTEDLSSEADPSTVADSQDTTLSESSFLHEPQG
TPRDPAATSKPSGKPAPENLKSPSWMSKS
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atggccctggtgaccctgcagcgctcgcccacgcccagcgccgcctcctcctcggccagc
aacagcgagttggaggctggcagcgaagaagatcgaaaattaaacctcagcttaagtgag
agctttttcatggtgaaaggcgcagccctcttcttacaacagggaagcagccctcaaggc
cagcggagtcttcagcacccccacaagcatgcaggtgatctgcctcaacatcttcaggtg
atgatcaaccttctgcgttgcgaagacagaatcaagctggcagtgcgcctggagagcgcc
tgggcggaccgggtccggtacatggtggtggtgtacagcagcgggcgccaggacaccgag
gagaatatcttgctgggagtggacttttccagtaaggaaagtaaaagctgcaccattggg
atggttctccgactgtggagcgacacgaaaatccaccttgatggagatggtgggttcagc
gtgagcacagcaggaaggatgcacatatttaagcctgtgtctgtccaggccatgtggtct
gccctgcaggtgcttcacaaggcctgcgaagtggcccggaggcacaactacttccccggg
ggtgtagctctcatctgggctacctactatgagagctgcatcagctccgagcagagctgc
atcaacgagtggaacgccatgcaggacctggagtctacgcggcccgactcccccgcgcta
tttgtggacaagcccactgaaggggaaaggaccgagcgcctcatcaaagccaagctccga
agcatcatgatgagccaggatctagaaaatgtgacttccaaagagattcgtaatgaatta
gagaaacagatgaattgtaacttgaaggaactcaaggaatttatagacaatgagatgcta
cttatcttgggacagatggacaagccctcccttatcttcgatcatctttatctcggctct
gaatggaatgcatccaatctggaggaactgcagggctcaggggttgattacattttaaat
gttaccagagaaatcgataatttttttcctggcttatttgcatatcataacatccgagtc
tacgatgaagagaccacagacctcctcgcccactggaatgaagcgtatcattttataaac
aaagcgaagaggaaccattccaagtgcctggtgcattgcaaaatgggcgtgagtcgctcg
gcctccacagtcatagcctatgcaatgaaggaattcggctggcctctggaaaaagcatat
aactatgtaaagcagaagcgcagcatcacgcgccccaacgcgggctttatgaggcagctg
tctgagtatgaaggcatcttggatgcaagcaaacagcggcacaacaagctgtggcgtcag
cagacagacagcagcctccagcagcctgtggatgaccctgcaggacctggcgacttcttg
ccagagaccccagatggcaccccggaaagccagctgcccttcttggatgatgccgcccag
cccggcttagggccccccctcccctgctgtttccggcgactctcagacccccttctgcct
tcccctgaggatgaaactggcagcttggtccacctggaggatccggagagggaggctctg
ttggaggaagctgctccacctgcagaggtgcacaggccggccagacagccccagcaaggt
tccggactctgtgagaaggatgtgaagaagaaactagagtttgggagtcccaaaggtcgg
agcggctccttgctgcaggtggaggagacggaaagggaggagggcctgggagcagggagg
tgggggcagcttccaacccagctcgatcaaaacctgctcaactcggagaacctaaacaac
aacagcaagaggagctgtcccaacggcatggaggatgatgctatatttgggatccttaac
aaagtgaagccttcctataaatcctgtgccgactgcatgtaccctacagccagcggggct
cctgaggcctccagggagcgatgtgaggaccccaatgctcccgccatctgcacccagcca
gccttcctaccccacatcacgtcctcccctgtggcccacttggccagcaggtcccgtgtt
ccggagaagccagcctctggcccaaccgaacctcccccgttcctaccaccagcaggctcc
aggagggcagacaccagtggccctggggctggagctgccctagagccaccagccagcctt
ttggaaccttccagagagaccccaaaagtcctgccaaagtccctccttttgaagaattct
cactgtgataagaaccctcccagcacagaagtggtaataaaggaagaatcgtcacccaag
aaagatatgaagccagccaaggacctgaggcttctgttcagtaatgaatctgagaagccg
acaaccaacagctacctgatgcagcaccaggagtccatcattcagctgcagaaggcaggc
ttggtccgcaagcacaccaaagagctagagcggctgaagagcgtgcctgcagacccagca
cctccctccagggatggccctgccagcaggctggaggccagcatccccgaggagagccag
gatccagccgcgctccacgagctgggccccctggttatgcccagccaggccgggagtgat
gagaagtcagaggccgcccccgcttcattggaaggaggctcactgaagagcccccctcct
ttcttctaccgcctggaccacaccagtagtttctcaaaagactttctgaagaccatctgc
tacacccccacctcctcttccatgagctccaacctgacccggagctccagcagcgatagc
atccacagtgtccgtgggaagcccgggctggtgaagcagcggacacaggagattgagacc
cggctccggctggcgggcctcaccgtctcttccccactgaagcgctcacactctcttgcc
aagctggggagtctcaccttctcaacggaagacctgtccagtgaggctgacccgtccacc
gtcgctgactcccaggacaccactttgagtgaatcttccttcttgcatgagccccaggga
accccgagggacccagctgcaacctccaaaccatcagggaaacccgccccagaaaactta
aagagcccttcgtggatgagcaaaagctga

KEGG   Homo sapiens (human): 54961Help
Entry
54961             CDS       T01001                                 

Gene name
SSH3, SSH3L
Definition
(RefSeq) slingshot protein phosphatase 3
  KO
K05766  protein phosphatase slingshot [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    54961 (SSH3)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    54961 (SSH3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    54961 (SSH3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     54961 (SSH3)
    3.1.3.48  protein-tyrosine-phosphatase
     54961 (SSH3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Slingshots
    54961 (SSH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc DEK_C Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 54961
NCBI-ProteinID: NP_060327
OMIM: 606780
HGNC: 30581
Ensembl: ENSG00000172830
Vega: OTTHUMG00000167105
Pharos: Q8TE77(Tdark)
UniProt: Q8TE77 A0A024R5J4
LinkDB All DBs
Position
11q13.2
AA seq 659 aa AA seqDB search
MALVTVSRSPPGSGASTPVGPWDQAVQRRSRLQRRQSFAVLRGAVLGLQDGGDNDDAAEA
SSEPTEKAPSEEELHGDQTDFGQGSQSPQKQEEQRQHLHLMVQLLRPQDDIRLAAQLEAP
RPPRLRYLLVVSTREGEGLSQDETVLLGVDFPDSSSPSCTLGLVLPLWSDTQVYLDGDGG
FSVTSGGQSRIFKPISIQTMWATLQVLHQACEAALGSGLVPGGSALTWASHYQERLNSEQ
SCLNEWTAMADLESLRPPSAEPGGSSEQEQMEQAIRAELWKVLDVSDLESVTSKEIRQAL
ELRLGLPLQQYRDFIDNQMLLLVAQRDRASRIFPHLYLGSEWNAANLEELQRNRVTHILN
MAREIDNFYPERFTYHNVRLWDEESAQLLPHWKETHRFIEAARAQGTHVLVHCKMGVSRS
AATVLAYAMKQYECSLEQALRHVQELRPIARPNPGFLRQLQIYQGILTASRQSHVWEQKV
GGVSPEEHPAPEVSTPFPPLPPEPEGGGEEKVVGMEESQAAPKEEPGPRPRINLRGVMRS
ISLLEPSLELESTSETSDMPEVFSSHESSHEEPLQPFPQLARTKGGQQVDRGPQPALKSR
QSVVTLQGSAVVANRTQAFQEQEQGQGQGQGEPCISSTPRFRKVVRQASVHDSGEEGEA
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggccctggtcacagtgagccgttcgcccccgggcagcggcgcctccacgcccgtgggg
ccctgggaccaggcggtccagcgaaggagtcgactccagcgaaggcagagctttgcggtg
ctccgtggggctgtcctgggactgcaggatggaggggacaatgatgatgcagcagaggcc
agttctgagccaacagagaaggccccgagtgaggaggagctccacggggaccagacagac
ttcgggcaaggatcccagagtccccagaagcaggaggagcagaggcagcacctgcacctc
atggtacagctgctgaggccgcaggatgacatccgcctggcagcccagctggaggcaccc
cggcctccccggctccgctacctgctggtagtttctacacgagaaggagaaggtctgagc
caggatgagacggtcctcctgggcgtggatttccctgacagcagctcccccagctgcacc
ctgggcctggtcttgcccctctggagtgacacccaggtgtacttagatggagacgggggc
ttcagcgtgacgtctggtgggcaaagccggatcttcaagcccatctccatccagaccatg
tgggccacactccaggtattgcaccaagcatgtgaggcagctctaggcagcggccttgta
ccgggtggcagtgccctcacctgggccagccactaccaggagagactgaactccgaacag
agctgcctcaatgagtggacggctatggccgacctggagtctctgcggcctcccagcgcc
gagcctggcgggtcctcagaacaggagcagatggagcaggcgatccgtgctgagctgtgg
aaagtgttggatgtcagtgacctggagagtgtcacttccaaagagatccgccaggctctg
gagctgcgcctggggctccccctccagcagtaccgtgacttcatcgacaaccagatgctg
ctgctggtggcacagcgggaccgagcctcccgcatcttcccccacctctacctgggctca
gagtggaacgcagcaaacctggaggagctgcagaggaacagggtcacccacatcttgaac
atggcccgggagattgacaacttctaccctgagcgcttcacctaccacaatgtgcgcctc
tgggatgaggagtcggcccagctgctgccgcactggaaggagacgcaccgcttcattgag
gctgcaagagcacagggcacccacgtgctggtccactgcaagatgggcgtcagccgctca
gcggccacagtgctggcctatgccatgaagcagtacgaatgcagcctggagcaggccctg
cgccacgtgcaggagctccggcccatcgcccgccccaaccctggcttcctgcgccagctg
cagatctaccagggcatcctgacggccagccgccagagccatgtctgggagcagaaagtg
ggtggggtctccccagaggagcacccagcccctgaagtctctacaccattcccacctctt
ccgccagaacctgagggtggtggggaggagaaggttgtaggcatggaagagagccaggca
gccccgaaagaagagcctgggccacggccacgtataaacctccgaggggtcatgaggtcc
atcagtcttctggagccctccttggagctggagagcacctcagagaccagtgacatgcca
gaggtcttctcttcccacgagtcttcacatgaagagcctctgcagcccttcccacagctt
gcaaggaccaagggaggccagcaggtggacagggggcctcagcctgccctgaagtcccgc
cagtcagtggttaccctccagggcagtgccgtggtggccaaccggacccaggccttccag
gagcaggagcaggggcaggggcaggggcagggagagccctgcatttcctctacgcccagg
ttccggaaggtggtgagacaggccagcgtgcatgacagtggagaggagggcgaggcctga

KEGG   Homo sapiens (human): 85464Help
Entry
85464             CDS       T01001                                 

Gene name
SSH2, SSH-2, SSH-2L
Definition
(RefSeq) slingshot protein phosphatase 2
  KO
K05766  protein phosphatase slingshot [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    85464 (SSH2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    85464 (SSH2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    85464 (SSH2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     85464 (SSH2)
    3.1.3.48  protein-tyrosine-phosphatase
     85464 (SSH2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Slingshots
    85464 (SSH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc DEK_C Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 85464
NCBI-ProteinID: NP_203747
OMIM: 606779
HGNC: 30580
Ensembl: ENSG00000141298
Vega: OTTHUMG00000132752
Pharos: Q76I76(Tdark)
UniProt: Q76I76
LinkDB All DBs
Structure
PDB: 

Position
17q11.2
AA seq 1423 aa AA seqDB search
MALVTVQRSPTPSTTSSPCASEADSGEEECRSQPRSISESFLTVKGAALFLPRGNGSSTP
RISHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRYMVVVSTNGRQDTEE
SIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHLDGDGGFSVSTDNRVHIFKPVSVQAMWSA
LQSLHKACEVARAHNYYPGSLFLTWVSYYESHINSDQSSVNEWNAMQDVQSHRPDSPALF
TDIPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIV
ILGQMDSPTQIFEHVFLGSEWNASNLEDLQNRGVRYILNVTREIDNFFPGVFEYHNIRVY
DEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIAYAMKEYGWNLDRAYD
YVKERRTVTKPNPSFMRQLEEYQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELN
KKDITTSADQIAEVKTMESHPPIPPVFVEHMVPQDANQKGLCTKERMICLEFTSREFHAG
QIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETD
ALKADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFV
ELSQETRSRSFSHSRMEELGGGRNESCRLSVVEVAPSKVTADDQRSSSLSNTPHASEESS
MDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTP
KKNSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEE
GEPAEGEQELQGSGMHPGAKWYPGSVRRATLEFEERLRQEQEHHGAAPTCTSLSTRKNSK
NDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVL
EFDHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIEYTHIVTS
PNHTGPGSEIATSEKSGEQGLRKVNMEKSVTVLCTLDENLNRTLDPNQVSLHPQVLPLPH
SSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHL
EGFTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPYKDSQLSSADLSLISKLGDNTGELQ
EKMDPLPVACRLPHSSSSENIKSLSHSPGVVKERAKEIESRVVFQAGLTKPSQMRRSASL
AKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPT
KSFVEQLTTTECIVQSKPVERPLVQYAKEFGSSQQYLLPRAGLELTSSEGGLPVLQTQGL
QCACPAPGLAVAPRQQHGRTHPLRRLKKANDKKRTTNPFYNTM
NT seq 4272 nt NT seq  +upstreamnt  +downstreamnt
atggctttggtcacggtccagcggtcacctacccccagcaccacctccagcccctgcgcc
tcggaggcagacagtggggaggaagaatgccggtcacagcccaggagcatcagcgagagc
tttctaactgtcaaaggtgctgccctttttctaccacggggaaatggctcatccacacca
agaatcagccacagacggaacaagcatgcaggcgatctccaacagcatctccaagcaatg
ttcattttactccgcccagaagacaacatcaggctggctgtaagactggaaagtacttac
cagaatcgaacacgctatatggtagtggtttcaactaatggtagacaagacactgaagaa
agcatcgtcctaggaatggatttctcctctaatgacagtagcacttgtaccatgggctta
gttttgcctctctggagcgacacgctaattcatttggatggtgatggtgggttcagtgta
tcgacggataacagagttcacatattcaaacctgtatctgtgcaggcaatgtggtctgca
ctacagagcttacacaaggcttgtgaagtcgccagagcgcataactactacccaggcagc
ctatttctcacttgggtgagttattatgagagccatatcaactcagatcaatcctcagtc
aatgaatggaatgcaatgcaagatgtacagtcccaccggcccgactctccagctctcttc
accgacatacctactgaacgtgaacgaacagaaaggctaattaaaaccaaattaagggag
atcatgatgcagaaggatttggagaatattacatccaaagagataagaacagagttggaa
atgcaaatggtgtgcaacttgcgggaattcaaggaatttatagacaatgaaatgatagtg
atccttggtcaaatggatagccctacacagatatttgagcatgtgttcctgggctcagaa
tggaatgcctccaacttagaggacttacagaaccgaggggtacggtatatcttgaatgtc
actcgagagatagataacttcttcccaggagtctttgagtatcataacattcgggtatat
gatgaagaggcaacggatctcctggcgtactggaatgacacttacaaattcatctctaaa
gcaaagaaacatggatctaaatgccttgtgcactgcaaaatgggggtgagtcgctcagcc
tccaccgtgattgcctatgcaatgaaggaatatggctggaatctggaccgagcctatgac
tatgtgaaagaaagacgaacggtaaccaagcccaacccaagcttcatgagacaactggaa
gagtatcaggggatcttgctggcaagcaaacagcggcataacaaactatggagatctcat
tcagatagtgacctctcagaccaccacgaacccatctgcaaacctgggctagaactcaac
aagaaggatatcaccacctcagcagaccagattgctgaggtgaagaccatggagagtcac
ccacccatacctcctgtctttgtggaacatatggtcccacaagatgcaaatcagaaaggc
ctgtgtaccaaagaaagaatgatctgcttggagtttacttctagggaatttcatgctgga
cagattgaggatgaattaaacttaaatgacatcaatggatgctcatcagggtgttgtctg
aatgaatcaaaatttcctcttgacaattgccatgcatccaaagccttaattcagcctgga
catgtcccagaaatggccaacaagtttccagacttaacagtggaagatttggagacagat
gcactgaaagcagacatgaatgtccacctactgcctatggaagaattgacatctccactg
aaagacccccccatgtcccctgatcctgagtcaccaagcccccaacccagttgccagact
gaaatctcagatttcagtacagatcgcattgacttttttagtgccctagagaagtttgtg
gagctctcccaagaaacccggtcacgatctttttcccattcaaggatggaggaactgggt
ggaggaaggaatgagagctgtcgactgtcagtggtagaagtagccccttccaaagtgaca
gctgatgaccagagaagcagctctttgagtaatactccccatgcatcagaagaatcttca
atggatgaggaacagtcaaaggcaatttcagaactggtcagcccagacatcttcatgcag
tctcactcggaaaatgcaatttcagtcaaagaaattgtcactgaaattgagtccatcagt
caaggagttgggcagattcaactgaaaggagacatcttacccaacccatgccatacacca
aagaagaacagcatccatgagctgctccttgagagggcccagactccagagaacaaacct
ggacatatggagcaagatgaggactcctgcacagcccagcctgaactagccaaagactca
gggatgtgcaacccagaaggctgcctaaccacacactcatctatagcagacttggaagaa
ggggaaccagctgagggggaacaagagctccagggctcagggatgcacccaggtgccaag
tggtaccctgggtctgtgaggcgagccaccttggagttcgaagagcgcttacggcaggag
caagagcatcatggtgctgccccaacatgtacctcattgtccactcgtaagaattcaaag
aatgattcttctgtggcagacctagcaccaaaagggaaaagtgatgaagcccccccagaa
cattcatttgtcctcaaggaaccagaaatgagcaaaggcaaagggaaatacagtgggtct
gaggctggctcactgtcccattctgagcagaatgccactgttccagctcccagggtgctg
gagtttgaccacttgccagatcctcaggagggcccagggtcagatactggaacacagcag
gaaggagtcctgaaggatctgaggactgtgattccataccaggagtctgaaacacaagca
gtccctcttccccttcccaagagggtagaaatcattgaatatacccacatagttacatca
cccaatcacactgggccagggagtgaaatagccaccagtgagaagagcggagagcaaggg
ctgaggaaagtgaacatggaaaaatctgtcactgtgctctgcacactggatgaaaatcta
aacaggactctggaccccaaccaggtttctctgcacccccaagtgctacctctgcctcat
tcttcctcccctgagcacaacagacccactgaccatccaacctccatcctgagtagccct
gaagacagaggcagcagcctgtccacagccctggagacagcagcaccttttgtcagtcat
acaacccatttactgtctgccagtttggattacctgcatccccagactatggttcacctg
gagggcttcacagagcagagcagcactacagatgagccctctgcagaacaggttagctgg
gaagaaagtcaggagagccctctctccagtggcagtgaggtgccatataaggactcccag
ctaagtagcgcagacctaagtttaattagcaaacttggtgacaacactggggagttacag
gagaaaatggacccattgcctgtagcctgtcgactcccacatagctctagtagtgaaaac
ataaagagtctcagccacagccccggtgtggtgaaggagcgtgctaaagaaatcgagtct
cgagtggttttccaggcagggctcaccaaaccatcccaaatgaggcgctcagcttctctc
gccaaattaggttacttggacctctgtaaagactgcttaccagagagggagcctgcctcc
tgtgaatcccctcatctcaaactgcttcagcctttcctcagaacagactcaggcatgcac
gcgatggaggaccaagagtccctagaaaacccaggtgccccccacaacccagagcccacc
aagtcttttgtagaacaactcacaacaacagagtgtattgtgcagagcaagccagtggag
aggccccttgtgcagtatgccaaagaatttggttctagtcagcagtatttgctccccagg
gcaggacttgaattgactagttctgaaggaggccttcccgtgctacagacccagggactg
cagtgtgcatgcccagctccagggctggccgtggcaccccgtcagcaacacggcagaact
cacccccttaggagactgaaaaaggcaaatgacaaaaaacggacaaccaaccccttctat
aataccatgtga

DBGET integrated database retrieval system