KEGG   Homo sapiens (human): 54437Help
Entry
54437             CDS       T01001                                 

Gene name
SEMA5B, SEMAG, SemG
Definition
(RefSeq) semaphorin 5B
  KO
K06841  semaphorin 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    54437 (SEMA5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema TSP_1 PSI
Motif
Other DBs
NCBI-GeneID: 54437
NCBI-ProteinID: NP_001026872
OMIM: 609298
HGNC: 10737
Ensembl: ENSG00000082684
Vega: OTTHUMG00000140392
Pharos: Q9P283(Tbio)
UniProt: Q9P283
LinkDB All DBs
Position
3q21.1
AA seq 1151 aa AA seqDB search
MPCGFSPSPVAHHLVPGPPDTPAQQLRCGWTVGGWLLSLVRGLLPCLPPGARTAEGPIMV
LAGPLAVSLLLPSLTLLVSHLSSSQDVSSEPSSEQQLCALSKHPTVAFEDLQPWVSNFTY
PGARDFSQLALDPSGNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEE
ECQNYVRVLIVAGRKVFMCGTNAFSPMCTSRQVGNLSRTIEKINGVARCPYDPRHNSTAV
ISSQGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYDIGLFAYFF
LRENAVEHDCGRTVYSRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQ
SAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPI
PNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQ
AKDTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARAL
FVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITA
CPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIAN
CSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCP
VPIFWASWGSWSKCSSNCGGGMQSRRRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWT
PWLPVNVTQGGARQEQRFRFTCRAPLADPHGLQFGRRRTETRTCPADGSGSCDTDALVEV
LLRSGSTSPHTVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQ
DCNPQACPVRGAWSCWTSWSPCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEEALCA
TQACPEGWSPWSEWSKCTDDGAQSRSRHCEELLPGSSACAGNSSQSRPCPYSEIPVILPA
SSMEEATDCAGFNLIHLVATGISCFLGSGLLTLAVYLSCQHCQRQSQESTLVHPATPNHL
HYKGGGTPKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSPLNKHSFRPE
ASPGQRCFPNS
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtggcttcagtccgtctcctgttgcccaccacctcgtccctgggccgcctgat
accccagcccaacagctaaggtgtggatggacagtagggggctggcttctctcactggtc
aggggtcttctcccctgtctgcctcccggagctaggactgcagaggggcctatcatggtg
cttgcaggccccctggctgtctcgctgttgctgcccagcctcacactgctggtgtcccac
ctctccagctcccaggatgtctccagtgagcccagcagtgagcagcagctgtgcgccctt
agcaagcaccccaccgtggcctttgaagacctgcagccgtgggtctctaacttcacctac
cctggagcccgggatttctcccagctggctttggacccctccgggaaccagctcatcgtg
ggagccaggaactacctcttcagactcagccttgccaatgtctctcttcttcaggccaca
gagtgggcctccagtgaggacacgcgccgctcctgccaaagcaaagggaagactgaggag
gagtgtcagaactacgtgcgagtcctgatcgtcgccggccggaaggtgttcatgtgtgga
accaatgccttttcccccatgtgcaccagcagacaggtggggaacctcagccggactatt
gagaagatcaatggtgtggcccgctgcccctatgacccacgccacaactccacagctgtc
atctcctcccagggggagctctatgcagccacggtcatcgacttctcaggtcgggaccct
gccatctaccgcagcctgggcagtgggccaccgcttcgcactgcccaatataactccaag
tggcttaatgagccaaacttcgtggcagcctatgatattgggctgtttgcatacttcttc
ctgcgggagaacgcagtggagcacgactgtggacgcaccgtgtactctcgcgtggcccgc
gtgtgcaagaatgacgtggggggccgattcctgctggaggacacatggaccacattcatg
aaggcccggctcaactgctcccgcccgggcgaggtccccttctactataacgagctgcag
agtgccttccacttgccggagcaggacctcatctatggagttttcacaaccaacgtaaac
agcatcgcggcttctgctgtctgcgccttcaacctcagtgctatctcccaggctttcaat
ggcccatttcgctaccaggagaaccccagggctgcctggctccccatagccaaccccatc
cccaatttccagtgtggcaccctgcctgagaccggtcccaacgagaacctgacggagcgc
agcctgcaggacgcgcagcgcctcttcctgatgagcgaggccgtgcagccggtgacaccc
gagccctgtgtcacccaggacagcgtgcgcttctcacacctcgtggtggacctggtgcag
gctaaagacacgctctaccatgtactctacattggcaccgagtcgggcaccatcctgaag
gcgctgtccacggcgagccgcagcctccacggctgctacctggaggagctgcacgtgctg
ccccccgggcgccgcgagcccctgcgcagcctgcgcatcctgcacagcgcccgcgcgctc
ttcgtggggctgagagacggcgtcctgcgggtcccactggagaggtgcgccgcctaccgc
agccagggggcatgcctgggggcccgggacccgtactgtggctgggacgggaagcagcaa
cgttgcagcacactcgaggacagctccaacatgagcctctggacccagaacatcaccgcc
tgtcctgtgcggaatgtgacacgggatgggggcttcggcccatggtcaccatggcaacca
tgtgagcacttggatggggacaactcaggctcttgcctgtgtcgagctcgatcctgtgat
tcccctcgaccccgctgtgggggccttgactgcctggggccagccatccacatcgccaac
tgctccaggaatggggcgtggaccccgtggtcatcgtgggcgctgtgcagcacgtcctgt
ggcatcggcttccaggtccgccagcgaagttgcagcaaccctgctccccgccacgggggc
cgcatctgcgtgggcaagagccgggaggaacggttctgtaatgagaacacgccttgcccg
gtgcccatcttctgggcttcctggggctcctggagcaagtgcagcagcaactgtggaggg
ggcatgcagtcgcggcgtcgggcctgcgagaacggcaactcctgcctgggctgcggcgtg
gagttcaagacgtgcaaccccgagggctgccccgaagtgcggcgcaacaccccctggacg
ccgtggctgcccgtgaacgtgacgcagggcggggcacggcaggagcagcggttccgcttc
acctgccgcgcgccccttgcagacccgcacggcctgcagttcggcaggagaaggaccgag
acgaggacctgtcccgcggacggctccggctcctgcgacaccgacgccctggtggaggtc
ctcctgcgcagcgggagcacctccccgcacacggtgagcgggggctgggccgcctggggc
ccgtggtcgtcctgctcccgggactgcgagctgggcttccgcgtccgcaagagaacgtgc
actaacccggagccccgcaacgggggcctgccctgcgtgggcgatgctgccgagtaccag
gactgcaacccccaggcttgcccagttcggggtgcttggtcctgctggacctcatggtct
ccatgctcagcttcctgtggtgggggtcactatcaacgcacccgttcctgcaccagcccc
gcaccctccccaggtgaggacatctgtctcgggctgcacacggaggaggcactatgtgcc
acacaggcctgcccagaaggctggtcgccctggtctgagtggagtaagtgcactgacgac
ggagcccagagccgaagccggcactgtgaggagctcctcccagggtccagcgcctgtgct
ggaaacagcagccagagccgcccctgcccctacagcgagattcccgtcatcctgccagcc
tccagcatggaggaggccaccgactgtgcagggttcaatctcatccacttggtggccacg
ggcatctcctgcttcttgggctctgggctcctgaccctagcagtgtacctgtcttgccag
cactgccagcgtcagtcccaggagtccacactggtccatcctgccacccccaaccatttg
cactacaagggcggaggcaccccgaagaatgaaaagtacacacccatggaattcaagacc
ctgaacaagaataacttgatccctgatgacagagccaacttctacccattgcagcagacc
aatgtgtacacgactacttactacccaagccccctgaacaaacacagcttccggcccgag
gcctcacctggacaacggtgcttccccaacagctga

KEGG   Homo sapiens (human): 9037Help
Entry
9037              CDS       T01001                                 

Gene name
SEMA5A, SEMAF, semF
Definition
(RefSeq) semaphorin 5A
  KO
K06841  semaphorin 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Disease
H00764  Chromosme 5p deletion syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    9037 (SEMA5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema TSP_1
Motif
Other DBs
NCBI-GeneID: 9037
NCBI-ProteinID: NP_003957
OMIM: 609297
HGNC: 10736
Ensembl: ENSG00000112902
Vega: OTTHUMG00000090501
Pharos: Q13591(Tbio)
UniProt: Q13591 X5DR95
LinkDB All DBs
Position
5p15.31
AA seq 1074 aa AA seqDB search
MKGTCVIAWLFSSLGLWRLAHPEAQGTTQCQRTEHPVISYKEIGPWLREFRAKNAVDFSQ
LTFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRV
LLVGGDRLFTCGTNAFTPVCTNRSLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELY
AATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH
DCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTFFLPEL
DLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQENSRSAWLPYPNPNPHFQCGTV
DQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHII
YLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVV
KIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVD
GHFGVWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPGMEIANCSRNGGWTP
WTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWG
PWERCTAQCGGGIQARRRICENGPDCAGCNVEYQSCNTNPCPELKKTTPWTPWTPVNISD
NGGHYEQRFRYTCKARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSA
HTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPV
DGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWS
EWSDWSECEASGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEE
KRCGEFNMFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAPLNTSITN
HINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaacctgtgttatagcatggctgttctcaagcctggggctgtggagactcgcc
cacccagaggcccagggtacgactcagtgccagagaaccgagcatccagtcatctcctat
aaagaaattggcccctggttacgggagttcagagcgaagaatgctgtggatttctcgcag
ttaacatttgacccaggacagaaagaacttgttgtaggagcaagaaactacctcttcagg
ttacagcttgaggatctgtctcttatccaggctgtggaatgggagtgtgatgaagctacc
aaaaaggcctgttacagcaaaggcaaatcaaaggaggaatgtcagaactacatccgggtg
cttctggtgggtggcgaccggttattcacctgtgggaccaatgcattcacgcctgtctgc
accaaccgctcgttgagcaacctgactgagatccatgatcagatcagtggcatggcccgc
tgtccctacagtccccagcacaattccacagcgctcctcacagctggtggggagctctat
gctgctacagccatggattttccaggacgtgatcctgccatttaccgaagcctaggcatt
ttacctcctctccgcacggcgcagtacaactccaaatggctcaatgagccaaactttgtg
tcatcttatgacatcggaaattttacctacttctttttccgagaaaatgcagtagagcat
gactgtgggaaaacagtgttctccagagctgcccgggtgtgcaagaacgatattggtggg
cgcttcctgctggaagacacctggaccacattcatgaaggctcgcctgaactgctcccgt
cctggggaagtccccttttactacaacgaattgcagagtactttcttcctgcctgagctg
gatttgatctatggcatctttaccaccaatgtgaacagcattgcggcctcagctgtgtgc
gtcttcaacctgagcgccatcgcgcaggccttctctgggcccttcaagtaccaagaaaac
tcgcgctcggcctggctaccgtatcccaacccaaacccccacttccagtgtggcaccgtg
gaccagggcctgtacgtgaacctgaccgagagaaatctgcaggatgctcagaagttcatt
ctgatgcatgaggtggtacagccagtgaccacagtgccctccttcatggaggacaatagc
cgcttttcccacgtggcagtcgacgtggtgcagggcagagaagcgctcgtccacatcatc
tatttggccacagattacggaaccattaagaaagtgcgggtacccctgaatcagacctca
agcagctgtttgctggaagagattgagctcttccctgagaggcggagggagcccatcagg
agcctgcagatcctgcacagccagagtgtcctgttcgtgggcctgcgggagcacgtggtc
aagatccccctgaagaggtgccagttctaccgcacacgcagcacctgcattggggcccag
gacccttactgtggctgggatgtggtaatgaagaaatgcacaagcctggaggagagcctg
agcatgacgcagtgggaacagagcatctctgcgtgtccgaccaggaatctcaccgtggat
gggcactttggtgtgtggtctccgtggacgccttgcacgcacacagatggcagcgccgtg
ggatcctgcctctgtcgaacccgctcctgcgacagcccggccccgcagtgtggtggctgg
cagtgcgagggccctggcatggagatcgccaactgttccaggaacggaggctggactccc
tggacctcgtggtctccctgcagcactacctgtgggatcggcttccaggtgcggcagcgc
tcctgcagcaaccccactcccaggcacgggggccgggtgtgcgtgggacagaaccgcgag
gaaagatactgcaatgaacatttgctatgtcccccacacatgttctggacaggctggggt
ccttgggaacggtgcacagcccaatgcgggggtggcattcaagctcgccgcaggatctgt
gagaatgggcctgactgtgcaggctgcaatgtggagtaccagtcttgcaacaccaacccg
tgtcctgagctgaagaagaccacgccctggacaccctggacacctgtcaacatctctgac
aacggcggccactatgagcaacgattccgatacacatgcaaagcccgcctggctgatccg
aatttgctggaagtgggaagacagagaatcgaaatgcggtactgttctagcgacggcacc
agtggctgctccacagatgggctttctggggatttcctgcgtgctgggagatactctgcc
cacacggtcaacggggcttggtcagcctggacgtcgtggtcacagtgcagccgtgactgc
agcaggggcattcggaaccggaagcgtgtttgcaacaaccccgaacccaagtatggggga
atgccttgccttggcccatctctggaataccaggaatgcaacattttgccctgcccagtg
gatggcgtgtggtcttgctggtccccctggacaaaatgttcagcaacatgcggcggtgga
cactatatgaggacccgctcttgctccaatccagccccggcctatggaggggacatctgc
ctggggctgcacacagaagaggcactctgcaacacgcagccctgcccagagagctggtcg
gagtggtcggactggtctgagtgtgaagcctctggcgtccaagtccgcgcccgccagtgc
atcctcctgttccccatgggcagccagtgctccgggaacaccacggagagccggccgtgt
gtgtttgactctaatttcatcccagaagtatctgtggcaagatccagtagcgtagaagag
aaaaggtgtggagagttcaacatgttccacatgatcgccgtggggctgagcagctccatc
ctcggctgcctcctcaccctgctcgtctatacttactgccagcggtaccagcagcaatcc
cacgatgcgactgtcatccaccccgtctcacctgccccccttaataccagcataaccaac
cacatcaacaaactggacaagtacgactcggtggaggccatcaaggcatttaacaaaaac
aacttgatcctagaggaaagaaacaaatacttcaacccacatctcactgggaagacctat
tctaatgcctactttacagatctcaataattatgatgagtactaa

DBGET integrated database retrieval system