KEGG   Homo sapiens (human): 5449
Entry
5449              CDS       T01001                                 

Gene name
POU1F1, CPHD1, GHF-1, PIT1, POU1F1a, Pit-1
Definition
(RefSeq) POU class 1 homeobox 1
  KO
K09363  POU domain transcription factor, class 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04935  Growth hormone synthesis, secretion and action
Network
nt06324  GHRH-GH-IGF signaling
  Element
N00910  GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
Disease
H00254  Growth hormone deficiency
H02036  Combined pituitary hormone deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    5449 (POU1F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5449 (POU1F1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    5449 (POU1F1)
SSDB
Motif
Pfam: Pou Homeodomain Homeobox_KN Lsr2
Other DBs
NCBI-GeneID: 5449
NCBI-ProteinID: NP_000297
OMIM: 173110
HGNC: 9210
Ensembl: ENSG00000064835
Vega: OTTHUMG00000158992
Pharos: P28069(Tbio)
UniProt: P28069
LinkDB
Structure
PDB: 
5WC9

Position
3p11.2
AA seq 291 aa
MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHY
GNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEE
PIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSF
KNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPS
SQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
NT seq 876 nt   +upstreamnt  +downstreamnt
atgagttgccaagcttttacttcggctgatacctttatacctctgaattctgacgcctct
gcaactctgcctctgataatgcatcacagtgctgccgagtgtctaccagtctccaaccat
gccaccaatgtgatgtctacagcaacaggacttcattattctgttccttcctgtcattat
ggaaaccagccatcaacctatggagtgatggcaggtagtttaaccccttgtctttataaa
tttcctgaccacaccttgagtcatggatttcctcctatacaccagcctcttctggcagag
gaccccacagctgctgatttcaagcaggaactcaggcggaaaagtaaattggtggaagag
ccaatagacatggattctccagaaatcagagaacttgaaaagtttgccaatgaatttaaa
gtgagacgaattaaattaggatacacccagacaaatgttggggaggccctggcagctgtg
catggctctgaattcagtcaaacaacaatctgccgatttgaaaatctgcagctcagcttt
aaaaatgcatgcaaactgaaagcaatattatccaaatggctggaggaagctgagcaagta
ggagctttgtacaatgaaaaagtgggagcaaatgaaaggaaaagaaaacgaagaacaact
ataagcattgctgctaaagatgctctggagagacactttggagaacagaataaaccttct
tctcaagagatcatgaggatggctgaagaactgaatctggagaaagaagtagtaagagtt
tggttttgcaaccggaggcagagagaaaaacgggtgaaaacaagtctgaatcagagttta
ttttctatttctaaggaacatcttgagtgcagataa

DBGET integrated database retrieval system