KEGG   Homo sapiens (human): 54566
Entry
54566             CDS       T01001                                 

Gene name
EPB41L4B, CG1, EHM2, LULU2
Definition
(RefSeq) erythrocyte membrane protein band 4.1 like 4B
  KO
K21111  band 4.1-like protein 4B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    54566 (EPB41L4B)
SSDB
Motif
Pfam: FERM_N FERM_C FERM_M FA ACBP
Other DBs
NCBI-GeneID: 54566
NCBI-ProteinID: NP_061987
OMIM: 610340
HGNC: 19818
Ensembl: ENSG00000095203
Vega: OTTHUMG00000020470
Pharos: Q9H329(Tbio)
UniProt: Q9H329 Q9NSG9 Q59GC2
LinkDB
Position
9q31.3
AA seq 900 aa
MLRFLRRTFGRRSMQRYARGAAGRGAAGLGDERDGGPRGGPAAAASSSALPAAPGGSVFP
AGGGPLLTGGAAVHISAAGAAKATLYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDL
VETDYFGLQFLDSAQVAHWLDHAKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYL
FVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAME
FDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFE
GANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSARTCKHLWKCAVE
HHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSR
RHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRWHPHSPNVSYPLPSPVLSS
SDRLPFGIEENGGTPFLTAASGRHHHQHQHQHQHQHHSNYSLSLTLENKEGPLRSPNSSS
KSLTKLSPGTPALFSEAAAHLKKLELETVKAAGPWPPLHININKAEEKKVSEKTLQTPLL
PSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQ
PAVEKPEIKPPRVRKLTRQYSFDEDDLPPDLAEAVGVTTSTTTNTTTAATQVSVPLPSPK
VQNVSSPHKSEGKGLLSPGAKSPSDRGGAFTLEPGDLLMDFTEATPLAEPASNPHCAHSR
CSPPLSLPMKEETTGVCMYPPIKTRLIKTFPVDTMNPFPDTFTTGPQFTADFRDSKLQCC
PGPTSPLIPAATLRPLTETVSTVQTIYTTRKPVSLAASAETLRQELEREKMMKRLLMTEL
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgctgcggttcctgcgccggacctttggccgccgctccatgcagcgctacgcgcggggc
gcggcggggcgcggggccgccgggctgggggacgagcgcgatggggggccacgggggggc
ccggccgccgccgcctcctcctcggcgctgcccgccgcgcccgggggcagcgtgttcccg
gcgggcggcgggcccctgctcaccggcggcgcggccgtgcacatctccgccgccggcgcc
gccaaggccaccctctactgccgcgtcttcctgctcgacgggaccgaagtgagcgtggac
ctgccgaaacatgccaaaggccaggatttgtttgatcagattgtgtaccacttggacctt
gtggaaacagattactttggcctccagttcctcgactctgcccaggttgcgcactggctg
gatcatgccaaacccataaaaaagcagatgaaaattggacctgcttatgctttacacttt
cgagttaaatactattcttcagaaccaaacaaccttcgtgaggagtttacaaggtacctg
tttgttttacaactcaggcatgacattctttctggaaaattgaaatgcccttatgaaaca
gctgtggaattagctgctctctgtctacaagcggagcttggggagtgcgagcttccagaa
cacacaccagagcttgtgtctgagtttcggttcattccaaatcagacagaagcaatggaa
tttgatatcttccagagatggaaagagtgcaggggaaagagccctgcccaggcggaactc
tcctatctgaataaagcgaagtggctggaaatgtatggggtagacatgcacgttgtcagg
ggaagagatggctgtgaatattctcttggactgaccccgacaggcatattaatctttgaa
ggagctaacaaaataggcttattcttttggcctaaaattaccaaaatggattttaaaaag
agcaaattgacactcgtggtggtcgaggatgatgatcagggacgtgagcaagagcacacg
tttgtgttccggttagacagtgccaggacctgcaaacacctttggaagtgtgcagttgag
caccacgcattcttccgactgcggacgccaggaaacagcaaatccaatagatccgacttt
atcaggctgggctctcgcttcagattcagtgggcggacagaatatcaagctacacatggc
tccaggttacgaagaaccagcacctttgagaggaagcctagtaaacgttatccatcccgg
agacattcaacgttcaaagcaagcaacccagtgatagcagcccagctctgctctaaaaca
aatccagaagtccataattaccagcctcaatatcatcctaatatccatcccagccagccc
cggtggcatcctcactctccaaatgtcagctacccgctcccttccccagtgcttagcagc
tcggaccggttgccttttggcattgaggagaatgggggcacaccgttcctcaccgcagct
tcaggaaggcatcaccaccagcaccagcatcagcatcagcaccagcaccactcaaactac
agcctctcactgaccctggagaacaaagaggggcctctgaggtccccaaactccagcagc
aagtcccttacaaaactgagtccaggaacacctgccttgttcagtgaagccgctgcccat
ctaaagaagctggaactggaaactgtgaaggctgctggaccctggcctcctctgcacatc
aacataaacaaggctgaagaaaagaaagtctcggagaaaactcttcagactccacttttg
ccttcccctgttgcggatcatgtgaagtgtaacattctgaaagcccagttggaaaatgct
tcccgagtgaacatccagggtggaaaggaggaatcaccgtttgtaaatatcaataagaaa
tccagtcttcaggacgctagtgtaagaagtcctattcctattcgtgtggaaactgcccag
ccagctgtggaaaagccggaaatcaagcctccccgagtgaggaagttaacaagacagtat
agttttgatgaagacgacctccctccagacctggccgaggcagtgggagtgaccacatct
acaaccacaaacaccacaacggccgccacacaagtctccgtgccgctgccgtcccccaag
gtccagaatgtcagctcgcctcacaagtcagaaggcaaaggcctgctgtcccctggggcc
aagagcccctctgaccgaggaggtgcctttaccctggagccgggtgatcttctgatggat
ttcacagaagccactcctctggcagagcccgccagcaacccccactgtgcccactctcgc
tgttctcctccactctctctccccatgaaggaagagaccactggagtttgcatgtaccct
ccaatcaaaacgaggctgataaaaacattcccggttgatacaatgaacccgtttcctgat
actttcaccacagggccacagtttactgcagacttcagagacagtaaattacagtgctgt
cctggcccgacttccccgctgatcccagcagcgaccctgaggcctttgacagagaccgtc
tccacagtgcagaccatttacaccacccggaaacctgtttctctggcagccagtgcagag
acactccggcaggaactggagagagagaagatgatgaaaagactgttgatgaccgaactg
tga

DBGET integrated database retrieval system