KEGG   Homo sapiens (human): 54575
Entry
54575             CDS       T01001                                 

Gene name
UGT1A10, GNT1, UDPGT, UGT-1A, UGT-1J, UGT1, UGT1-01, UGT1-10, UGT1.1, UGT1.10, UGT1A, UGT1A1, UGT1J, hUG-BR1
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A10
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa04976  Bile secretion
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54575 (UGT1A10)
   00053 Ascorbate and aldarate metabolism
    54575 (UGT1A10)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54575 (UGT1A10)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54575 (UGT1A10)
   00860 Porphyrin and chlorophyll metabolism
    54575 (UGT1A10)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54575 (UGT1A10)
   00982 Drug metabolism - cytochrome P450
    54575 (UGT1A10)
   00983 Drug metabolism - other enzymes
    54575 (UGT1A10)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    54575 (UGT1A10)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    54575 (UGT1A10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54575 (UGT1A10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54575 (UGT1A10)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54575 (UGT1A10)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 54575
NCBI-ProteinID: NP_061948
OMIM: 606435
HGNC: 12531
Ensembl: ENSG00000242515
Vega: OTTHUMG00000059121
Pharos: Q9HAW8(Tbio)
UniProt: Q9HAW8 Q5DT02
LinkDB
Position
2q37.1
AA seq 530 aa
MARAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
EVSWQLERSLNCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLF
FSHCRSLFNDRKLVEYLKESSFDAVFLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEG
AQCPAPLSYVPNDLLGFSDAMTFKERVWNHIVHLEDHLFCQYLFRNALEIASEILQTPVT
AYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggctcgcgcagggtggaccagccccgttcctttatgtgtgtgtctactgctgacctgt
ggctttgccgaggcagggaagctgctggtagtgcccatggatgggagtcactggttcacc
atgcagtcggtggtggagaaacttatcctcagggggcatgaggtggttgtagtcatgcca
gaggtgagttggcaactggaaagatcactgaattgcacagtgaagacttactcaacctcg
tacactctggaagatcagaaccgggaattcatggttttcgcccatgctcaatggaaagca
caggcacaaagtatattttctctattaatgagttcatccagtggttttcttgacttattt
ttttcgcattgcaggagtttgtttaatgaccgaaaattagtagaatacttaaaggagagt
tcttttgatgcagtgtttctggatccttttgatacctgtggcttaattgttgctaaatat
ttctccctcccctctgtggtcttcaccaggggaatattttgccaccatcttgaagaaggt
gcacagtgccctgctcctctttcctatgtccccaatgatctcttagggttctcagatgcc
atgactttcaaggagagagtatggaaccacatcgtgcacttggaggaccatttattttgc
cagtatctttttagaaatgccctagaaatagcctctgaaattctccaaacccctgtcacg
gcatatgatctctacagtcacacatcaatttggttgttgcgaacggactttgttttggac
tatcccaaacccgtgatgcccaacatgatcttcattggtggtatcaactgtcatcaggga
aagccattgcctatggaatttgaagcctacattaatgcttctggagaacatggaattgtg
gttttctctttgggatcaatggtctcagaaattccagagaagaaagctatggcaattgct
gatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacccgaccatcg
aatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgatctgcttggtcac
ccgatgacccgtgcctttatcacccatgctggttcccatggtgtttatgaaagcatatgc
aatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaatgcaaagcgc
atggagactaagggagctggagtgaccctgaatgttctggaaatgacttctgaagattta
gaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgcccggtggagccgctggacctggccgtgttctgggtggag
tttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccacgacctcacctgg
taccagtaccattccttggacgtgattggtttcctcttggccgtcgtgctgacagtggcc
ttcatcacctttaaatgttgtgcttatggctaccggaaatgcttggggaaaaaagggcga
gttaagaaagcccacaaatccaagacccattga

DBGET integrated database retrieval system