KEGG   Homo sapiens (human): 54677
Entry
54677             CDS       T01001                                 

Gene name
CROT, COT
Definition
(RefSeq) carnitine O-octanoyltransferase
  KO
K05940  carnitine O-octanoyltransferase [EC:2.3.1.137]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    54677 (CROT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.137  carnitine O-octanoyltransferase
     54677 (CROT)
SSDB
Motif
Pfam: Carn_acyltransf
Other DBs
NCBI-GeneID: 54677
NCBI-ProteinID: NP_066974
OMIM: 606090
HGNC: 2366
Ensembl: ENSG00000005469
Vega: OTTHUMG00000023653
Pharos: Q9UKG9(Tbio)
UniProt: Q9UKG9
LinkDB
Position
7q21.12
AA seq 612 aa
MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQS
GIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGT
QLERGSITLWHNLNYWQLLRKEKVPVHKVGNTPLDMNQFRMLFSTCKVPGITRDSIMNYF
RTESEGRSPNHIVVLCRGRAFVFDVIHEGCLVTPPELLRQLTYIHKKCHSEPDGPGIAAL
TSEERTRWAKAREYLIGLDPENLALLEKIQSSLLVYSMEDSSPHVTPEDYSEIIAAILIG
DPTVRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNEGRWKGSEKVR
DIPLPEELIFIVDEKVLNDINQAKAQYLREASDLQIAAYAFTSFGKKLTKNKMLHPDTFI
QLALQLAYYRLHGHPGCCYETAMTRHFYHGRTETMRSCTVEAVRWCQSMQDPSVNLRERQ
QKMLQAFAKHNKMMKDCSAGKGFDRHLLGLLLIAKEEGLPVPELFTDPLFSKSGGGGNFV
LSTSLVGYLRVQGVVVPMVHNGYGFFYHIRDDRFVVACSAWKSCPETDAEKLVQLTFCAF
HDMIQLMNSTHL
NT seq 1839 nt   +upstreamnt  +downstreamnt
atggaaaatcaattggctaaatcaactgaagaacgaacatttcagtaccaggattctctt
ccatcactgcctgttccttcacttgaagaatcattaaaaaaataccttgaatcagtgaaa
ccatttgcaaatcaagaagaatataagaaaactgaagaaatagttcaaaaatttcaaagt
gggattggagaaaaattgcaccagaaattgcttgaaagagcaaaaggaaaaagaaattgg
ctggaagagtggtggctgaatgttgcctatctggatgttcgtataccatcacaattgaat
gtcaactttgcgggtcctgcagctcattttgaacactactggcctccaaaggaagggact
caattagaaagaggaagtataactctttggcataacttgaactactggcagctattaaga
aaagaaaaagtgcctgttcataaagttggaaatactcctctagatatgaatcaattccga
atgctattttctacctgcaaggttccaggaattactagagactccattatgaattatttt
aggactgagagtgaagggcgttccccaaaccacattgtagtgctgtgtcgaggccgagct
tttgtctttgatgtaatacatgaaggatgtttggtcaccccgccagagcttctcagacaa
ctgacatatatccacaagaagtgccatagtgaacctgatggacctgggattgcagcatta
actagtgaggagcgaactcgatgggctaaggcacgagaatatctgattggtcttgatcca
gagaacttggctttgttagaaaaaattcagagtagtttactggtatattccatggaggat
agcagtccacatgtaacaccagaggattattctgagattattgcagccatccttattgga
gatccaacagtacgctggggtgacaaatcctataacttgatttccttttctaatggagta
tttggctgtaattgtgatcatgctccttttgatgcaatgattatggtgaacatcagttat
tatgtggatgagaaaatttttcagaatgaaggaagatggaagggttcagagaaggtacga
gatataccacttccagaagagctcattttcattgtggatgagaaagttttaaatgacatc
aaccaagctaaagcccagtatctcagggaggcatctgatctacagattgcggcttatgcc
tttacatcttttggcaaaaagctaaccaagaacaagatgcttcacccggatacgtttatt
cagcttgcacttcagctggcctattacagacttcatggacaccctggttgttgctatgaa
acagctatgacaagacatttttatcatggccgtacagagactatgcgatcatgcacagtt
gaagcagtgaggtggtgccagtccatgcaggatccttctgtcaatcttcgtgagcggcag
caaaagatgttacaagcttttgcaaagcataataaaatgatgaaagattgttcagctgga
aaaggatttgatcgtcaccttttaggtctcttactcatagcaaaagaggaaggtcttcct
gttccagaactctttacggacccacttttttccaaaagcggaggaggtggaaattttgtt
ctctcaacaagtctggttggctatttacgagtccagggagtggtagttcccatggtacac
aatggttatggatttttctaccatatcagagatgacaggtttgttgtggcctgttcagcc
tggaaatcctgtcccgagactgatgcggaaaagctagttcagctgactttttgtgctttt
catgatatgatacagctgatgaactctactcatctttag

DBGET integrated database retrieval system