KEGG   Homo sapiens (human): 5469Help
Entry
5469              CDS       T01001                                 

Gene name
MED1, CRSP1, CRSP200, DRIP205, DRIP230, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2
Definition
(RefSeq) mediator complex subunit 1
  KO
K15144  mediator of RNA polymerase II transcription subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    5469 (MED1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5469 (MED1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5469 (MED1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Middle
     5469 (MED1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med1
Motif
Other DBs
NCBI-GeneID: 5469
NCBI-ProteinID: NP_004765
OMIM: 604311
HGNC: 9234
Ensembl: ENSG00000125686
Vega: OTTHUMG00000133216
Pharos: Q15648(Tbio)
UniProt: Q15648
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 1581 aa AA seqDB search
MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVS
CLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQL
CDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSL
EQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPI
ILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLP
ACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHN
MRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTL
IGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLY
KGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNL
PPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQ
NPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTL
YGSSPLERQNSSSGSPRMEICSGSNKTKKKKSSRLPPEKPKHQTEDDFQRELFSMDVDSQ
NPIFDVNMTADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPSIQRMVRLSSSDSIGPDVT
DILSDIAEEASKLPSTSDDCPAIGTPLRDSSSSGHSQSTLFDSDVFQTNNNENPYTDPAD
LIADAAGSPSSDSPTNHFFHDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFAS
QALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTT
GDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGK
SPSHSSSNRPFTPPTSTGGSKSPGSAGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSH
SQYTSSGSVSSSGSKSHHSHSSSSSSSASTSGKMKSSKSEGSSSSKLSSSMYSSQGSSGS
SQSKNSSQSGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPPG
GSDKLASPMKPVPGTPPSSKAKSPISSGSGGSHMSGTSSSSGMKSSSGLGSSGSLSQKTP
PSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPG
GEDPLDGQMGVSTNSSSHPMSSKHNMSGGEFQGKREKSDKDKSKVSTSGSSVDSSKKTSE
SKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGST
PKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSTEKHKKH
KKEKKKVKDKDRDRDRDKDRDKKKSHSIKPESWSKSPISSDQSLSMTSNTILSADRPSRL
SPDFMIGEEDDDLMDVALIGN
NT seq 4746 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctcagggggaaaccgaggagtcagaaaagctgagtaagatgagttctctcctg
gaacggctccatgcaaaatttaaccaaaatagaccctggagtgaaaccattaagcttgtg
cgtcaagtcatggagaagagggttgtgatgagttctggagggcatcaacatttggtcagc
tgtttggagacattgcagaaggctctcaaagtaacatctttaccagcaatgactgatcgt
ttggagtccatagcaagacagaatggactgggctctcatctcagtgccagtggcactgaa
tgttacatcacgtcagatatgttctatgtggaagtgcagttagatcctgcaggacagctt
tgtgatgtaaaagtggctcaccatggggagaatcctgtgagctgtccggagcttgtacag
cagctaagggaaaaaaattttgatgaattttctaagcaccttaagggccttgttaatctg
tataaccttccaggggacaacaaactgaagactaaaatgtacttggctctccaatcctta
gaacaagatctttctaaaatggcaattatgtactggaaagcaactaatgctggtcccttg
gataagattcttcatggaagtgttggctatctcacaccaaggagtgggggtcatttaatg
aacctgaagtactatgtctctccttctgacctactggatgacaagactgcatctcccatc
attttgcatgagaataatgtttctcgatctttgggcatgaatgcatcagtgacaattgaa
ggaacatctgctgtgtacaaactcccaattgcaccattaattatggggtcacatccagtt
gacaataaatggaccccttccttctcctcaatcaccagtgccaacagtgttgatcttcct
gcctgtttcttcttgaaatttccccagccaatcccagtatctagagcatttgttcagaaa
ctgcagaactgcacaggaattccattgtttgaaactcaaccaacttatgcacccctgtat
gaactgatcactcagtttgagctatcaaaggaccctgaccccatacctttgaatcacaac
atgagattttatgctgctcttcctggtcagcagcactgctatttcctcaacaaggatgct
cctcttccagatggccgaagtctacagggaacccttgttagcaaaatcacctttcagcac
cctggccgagttcctcttatcctaaatctgatcagacaccaagtggcctataacaccctc
attggaagctgtgtcaaaagaactattctgaaagaagattctcctgggcttctccaattt
gaagtgtgtcctctctcagagtctcgtttcagcgtatcttttcagcaccctgtgaatgac
tccctggtgtgtgtggtaatggatgtgcaggactcaacacatgtgagctgtaaactctac
aaagggctgtcggatgcactgatctgcacagatgacttcattgccaaagttgttcaaaga
tgtatgtccatccctgtgacgatgagggctattcggaggaaagctgaaaccattcaagcc
gacaccccagcactgtccctcattgcagagacagttgaagacatggtgaaaaagaacctg
cccccggctagcagcccagggtatggcatgaccacaggcaacaacccaatgagtggtacc
actacaccaaccaacacctttccggggggtcccattaccaccttgtttaatatgagcatg
agcatcaaagatcggcatgagtcggtgggccatggggaggacttcagcaaggtgtctcag
aacccaattcttaccagtttgttgcaaatcacagggaacggggggtctaccattggctcg
agtccgacccctcctcatcacacgccgccacctgtctcttcgatggccggcaacaccaag
aaccacccgatgctcatgaaccttcttaaagataatcctgcccaggatttctcaaccctt
tatggaagcagccctttagaaaggcagaactcctcttccggctcaccccgcatggaaata
tgctcggggagcaacaagaccaagaaaaagaagtcatcaagattaccacctgagaaacca
aagcaccagactgaagatgactttcagagggagctattttcaatggatgttgactcacag
aaccctatctttgatgtcaacatgacagctgacacgctggatacgccacacatcactcca
gctccaagccagtgtagcactcccccaacaacttacccacaaccagtacctcacccccaa
cccagtattcaaaggatggtccgactatccagttcagacagcattggcccagatgtaact
gacatcctttcagacattgcagaagaagcttctaaacttcccagcactagtgatgattgc
ccagccattggcacccctcttcgagattcttcaagctctgggcattctcagagtaccctg
tttgactctgatgtctttcaaactaacaataatgaaaatccatacactgatccagctgat
cttattgcagatgctgctggaagccccagtagtgactctcctaccaatcatttttttcat
gatggagtagatttcaatcctgatttattgaacagccagagccaaagtggttttggagaa
gaatattttgatgaaagcagccaaagtggggataatgatgatttcaaaggatttgcatct
caggcactaaatactttgggggtgccaatgcttggaggtgataatggggagaccaagttt
aagggcaataaccaagccgacacagttgatttcagtattatttcagtagccggcaaagct
ttagctcctgcagatcttatggagcatcacagtggtagtcagggtcctttactgaccact
ggggacttagggaaagaaaagactcaaaagagggtaaaggaaggcaatggcaccagtaat
agtactctctcggggcccggattagacagcaaaccagggaagcgcagtcggaccccttct
aatgatgggaaaagcaaagataagcctccaaagcggaagaaggcagacactgagggaaag
tctccatctcatagttcttctaacagaccttttaccccacctaccagtacaggtggatct
aaatcgccaggcagtgcaggaagatctcagactcccccaggtgttgccacaccacccatt
cccaaaatcactattcagattcctaagggaacagtgatggtgggcaagccttcctctcac
agtcagtataccagcagtggttctgtgtcttcctcaggcagcaaaagccaccatagccat
tcttcctcctcttcctcatctgcttccacctcagggaagatgaaaagcagtaaatcagaa
ggttcatcaagttccaagttaagtagcagtatgtattctagccaggggtcttctggatct
agccagtccaaaaattcatcccagtctggggggaagccaggctcctctcccataaccaag
catggactgagcagtggctctagcagcaccaagatgaaacctcaaggaaagccatcatca
cttatgaatccttctttaagtaaaccaaacatatccccttctcattcaaggccacctgga
ggctctgacaagcttgcctctccaatgaagcctgttcctggaactcctccatcctctaaa
gccaagtcccctatcagttcaggttctggtggttctcatatgtctggaactagttcaagc
tctggcatgaagtcatcttcagggttaggatcctcaggctcgttgtcccagaaaactccc
ccatcatctaattcctgtacggcatcttcctcctccttttcctcaagtggctcttccatg
tcatcctctcagaaccagcatgggagttctaaaggaaaatctcccagcagaaacaagaag
ccgtccttgacagctgtcatagataaactgaagcatggggttgtcaccagtggccctggg
ggtgaagacccactggacggccagatgggggtgagcacaaattcttccagccatcctatg
tcctccaaacataacatgtcaggaggagagtttcagggcaagcgtgagaaaagtgataaa
gacaaatcaaaggtttccacctccgggagttcagtggattcttctaagaagacctcagag
tcaaaaaatgtggggagcacaggtgtggcaaaaattatcatcagtaagcatgatggaggc
tcccctagcattaaagccaaagtgactttgcagaaacctggggaaagtagtggagaaggg
cttaggcctcaaatggcttcttctaaaaactatggctctccactcatcagtggttccact
ccaaagcatgagcgtggctctcccagccatagtaagtcaccagcatataccccccagaat
ctggacagtgaaagtgagtcaggctcctccatagcagagaaatcttatcagaatagtccc
agctcagacgatggtatccgaccacttccagaatacagcacagagaaacataagaagcac
aaaaaggaaaagaagaaagtaaaagacaaagatagggaccgagaccgggacaaagaccga
gacaagaaaaaatctcatagcatcaagccagagagttggtccaaatcacccatctcttca
gaccagtccttgtctatgacaagtaacacaatcttatctgcagacagaccctcaaggctc
agcccagactttatgattggggaggaagatgatgatcttatggatgtggccctgattggg
aattag

DBGET integrated database retrieval system