KEGG   Homo sapiens (human): 54738Help
Entry
54738             CDS       T01001                                 

Gene name
FEV, HSRNAFEV, PET-1
Definition
(RefSeq) FEV transcription factor, ETS family member
  KO
K09437  ETS oncogene family protein FEV
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Disease
H00035  Ewing sarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    54738 (FEV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    54738 (FEV)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    54738 (FEV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 54738
NCBI-ProteinID: NP_059991
OMIM: 607150
HGNC: 18562
Ensembl: ENSG00000163497
Vega: OTTHUMG00000133080
Pharos: Q99581(Tbio)
UniProt: Q99581
LinkDB All DBs
Structure
PDB: 

Position
2q35
AA seq 238 aa AA seqDB search
MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADR
ANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGK
RYAYRFDFQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNL
MAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagacagagcggcgcctcccagcccctgctgatcaacatgtacctgccagatcccgtc
ggagacggtctcttcaaggacgggaagaacccgagctgggggccgctgagccccgcggtt
cagaaaggcagcggacagatccagctgtggcagtttctgctggagctgctggctgaccgc
gcgaacgccggctgcatcgcgtgggagggcggtcacggcgagttcaagctcacggacccg
gacgaggtggcgcggcggtggggcgagcgcaagagcaagcccaacatgaactacgacaag
ctgagccgcgccctgcgctactactacgacaagaacatcatgagcaaggtgcatggcaag
cgctacgcctaccgcttcgacttccagggcctggcgcaggcctgccagccgccgcccgcg
cacgctcatgccgccgccgcagctgctgccgccgccgcggccgcccaggacggcgcgctc
tacaagctgcccgccggcctcgccccgctgcccttccccggcctctccaaactcaacctc
atggccgcctcggccggggtcgcgcccgccggcttctcctactggccgggcccgggcccc
gccgccaccgctgccgccgccaccgccgcgctctaccccagtcccagcttgcagcccccg
cccgggcccttcggggccgtggccgcagcctcgcacttggggggccattaccactag

DBGET integrated database retrieval system