KEGG   Homo sapiens (human): 54776Help
Entry
54776             CDS       T01001                                 

Gene name
PPP1R12C, AAVS1, LENG3, MBS85, p84, p85
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12C
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04510  Focal adhesion
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    54776 (PPP1R12C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    54776 (PPP1R12C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    54776 (PPP1R12C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    54776 (PPP1R12C)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    54776 (PPP1R12C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    54776 (PPP1R12C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     54776 (PPP1R12C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 PRKG1_interact Ank_4 Ank_5 Ank_3 Ank DUF4695
Motif
Other DBs
NCBI-GeneID: 54776
NCBI-ProteinID: NP_060077
OMIM: 613245
HGNC: 14947
Ensembl: ENSG00000125503
Vega: OTTHUMG00000180540
Pharos: Q9BZL4(Tdark)
UniProt: Q9BZL4
LinkDB All DBs
Position
19q13.42
AA seq 782 aa AA seqDB search
MSGEDGPAAGPGAAAAAARERRREQLRQWGARAGAEPGPGERRARTVRFERAAEFLAACA
GGDLDEARLMLRAADPGPGAELDPAAPPPARAVLDSTNADGISALHQACIDENLEVVRFL
VEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAESDAME
GLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAAKGYI
EVMRLLLQAGYDPELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRPCDLA
DEEVLSLLEELARKQEDLRNQKEASQSRGQEPQAPSSSKHRRSSVCRLSSREKISLQDLS
KERRPGGAGGPPIQDEDEGEEGPTEPPPAEPRTLNGVSSPPHPSPKSPVQLEEAPFSRRF
GLLKTGSSGALGPPERRTAEGAPGAGLQRSASSSWLEGTSTQAKELRLARITPTPSPKLP
EPSVLSEVTKPPPCLENSSPPSRIPEPESPAKPNVPTASTAPPADSRDRRRSYQMPVRDE
ESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKAAGKAPESEKPAQSLDPSRRPRVPGVE
NSDSPAQRAEAPDGQGPGPQAAREHRKVGKEWRGPAEGEEAEPADRSQESSTLEGGPSAR
RQRWQRDLNPEPEPESEEPDGGFRTLYAELRRENERLREALTETTLRLAQLKVELERATQ
RQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKL
SK
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgtccggagaggatggcccggcggctggcccgggggcggcggcggcggctgcccgggag
cggcgacgggagcagctgcggcagtggggggcgcgggcgggcgccgagcctggccccgga
gagcgccgcgcccgcaccgtccgcttcgagcgcgccgccgagttcctggcggcctgtgcg
ggcggcgacctggacgaggcgcgtctgatgctgcgcgccgccgaccctggccccggcgcc
gagctcgaccccgccgcgccgccgcccgcccgcgccgtgctggactccaccaacgccgac
ggtatcagcgccctgcaccaggcctgcattgatgagaacctggaggtggtgcgcttcttg
gtggagcagggcgccactgtgaaccaggcagacaacgagggctggacgccactgcacgtg
gccgcctcctgtggctacctagatatcgccaggtacctcctgagccacggggccaacatc
gccgccgtcaacagtgacggggacctgcccctggacctggccgagtcggacgccatggag
gggctgctgaaggcggagatcgcccgccgaggtgtggatgtggaagcagccaagcgggca
gaagaggaattgctccttcatgacacgaggtgctggctgaatgggggcgccatgccagag
gcccggcacccccgcacaggcgcctctgccctgcacgtggctgctgccaagggctacatt
gaggtgatgaggttgctccttcaggctggctacgacccagagctccgggacggggacggc
tggactcccctgcacgcagcggcacactggggcgtggaggatgcctgccgcctgctggcc
gagcatggcgggggcatggactcactgacccatgcggggcagcgtccctgtgacctggcc
gatgaggaagtactgagcctgttggaggaactggcccggaaacaggaggaccttcggaac
caaaaagaagcttcccagagccggggccaggagccccaagcgccctctagcagcaaacac
agaaggagctctgtgtgtcgtctgagcagtcgcgagaagatttccctccaggacttgtcc
aaggagcgccggcctggtggggctggggggccccccatccaggacgaggatgagggggaa
gaaggtcccaccgaaccaccccctgcagaacccagaaccctcaatggcgtctcctccccg
ccgcaccccagccctaagagtcccgtgcagcttgaagaggcccccttctccaggcgcttt
ggcctcctgaagacagggagttctggtgccctgggtccccctgaaaggcggacagcggag
ggagcccctggggctgggctgcagcgctcggcttcctcctcctggctggaagggacctcc
actcaggccaaggagctccgtcttgccagaattaccccgaccccctccccgaagctgccg
gagccctctgtcctgtctgaggtcaccaagcctcctccttgcttggagaactcctcgcct
ccctccaggattccggagcctgaatccccagcgaagccaaacgtccccacagcctccacg
gcgcccccagcggactcccgggaccgacggaggtcctaccagatgcctgtgcgggatgag
gagtcggaatcccagagaaaagctcgctcccgtctcatgcgccagtctcggaggtccaca
cagggtgtgactcttacagacctgaaggaggcagagaaggctgcagggaaggccccagag
tcagagaagccggcgcagagcctggacccttcccgaaggccccgcgtccctggagtggag
aactctgacagccctgcccagagagcagaggcgcccgacgggcagggtccgggaccgcag
gcggccagggagcaccgcaaggtcggaaaggagtggagggggcctgcggagggggaggag
gcggagccggctgaccgcagccaggagtccagcaccctggagggcggcccctcggcccgc
aggcagcggtggcagcgggacctcaacccagaacctgagccagaatcggaagagccagac
ggaggctttaggacgctgtatgcagagctgcgcagggagaacgagcggcttcgcgaggcc
ctgaccgagaccacgctgcggctggcgcagctcaaggtggagctggagcgggccacgcag
aggcaagaacgcttcgctgagaggccagccctcctggaactggagagattcgagcgcagg
gccctggaacgcaaggccgcagagctggaggaggagctgaaggccctgtctgacctccgc
gctgacaaccagcgcctcaaggatgagaatgcagcgttgatccgcgtcatcagcaaactc
tccaagtga

DBGET integrated database retrieval system