KEGG   Homo sapiens (human): 5481
Entry
5481              CDS       T01001                                 

Gene name
PPID, CYP-40, CYPD
Definition
(RefSeq) peptidylprolyl isomerase D
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa05010  Alzheimer disease
hsa05131  Shigellosis
Network
nt06410  Calcium signaling
nt06460  Alzheimer disease
  Element
N01006  Mutation-caused aberrant Abeta to VGCC-Ca2+ -apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5481 (PPID)
   04218 Cellular senescence
    5481 (PPID)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5481 (PPID)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    5481 (PPID)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    5481 (PPID)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     5481 (PPID)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    5481 (PPID)
SSDB
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_7 TPR_11 TPR_12 TPR_9 TPR_16 TPR_17 TPR_19
Other DBs
NCBI-GeneID: 5481
NCBI-ProteinID: NP_005029
OMIM: 601753
HGNC: 9257
Ensembl: ENSG00000171497
Vega: OTTHUMG00000161927
Pharos: Q08752(Tchem)
UniProt: Q08752 E5KN55
LinkDB
Position
4q32.1
AA seq 370 aa
MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGH
TTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
ANAGRNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAE
CGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWE
MAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEAL
ELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDK
EKAVYAKMFA
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgtcgcacccgtccccccaagccaagccctccaaccccagtaaccctcgagtcttcttt
gacgtggacatcggaggggagcgagttggtcgaattgtcttagaattgtttgcagatatc
gtacccaaaactgcggaaaattttcgtgcactgtgtacaggagaaaaaggcattggacac
acgactgggaaacctctccatttcaaaggatgcccttttcatcgaattattaagaaattt
atgattcagggtggagacttctcaaatcagaatgggacaggtggagaaagtatttatggt
gaaaaatttgaagatgaaaatttccattacaagcatgatcgggagggtttactgagcatg
gcaaatgcaggccgcaacacaaacggttctcagttttttatcacaacagttccaactcct
catttggatgggaaacatgtggtgtttggccaagtaattaaaggaataggagtggcaagg
atattggaaaatgtggaagtgaaaggtgaaaaacctgctaaattgtgcgttattgcagaa
tgtggagaattgaaggaaggagatgacgggggaatattcccaaaagatggctctggcgac
agtcatccagatttccctgaggatgcggatatagatttaaaagatgtagataaaatttta
ttaataacagaagacttaaaaaacattggaaatacttttttcaaatcccagaactgggag
atggctattaaaaaatatgcagaagttttaagatacgtggacagttcaaaggctgttatt
gagacagcagatagagccaagctgcaacctatagctttaagctgtgtactgaatattggt
gcttgtaaactgaagatgtcaaattggcagggagcaattgacagttgtttagaggctctt
gaactagacccatcaaataccaaagcattgtaccgcagagctcaaggatggcaaggatta
aaagaatatgatcaagcattggctgatcttaagaaagctcaggggatagcaccagaagat
aaagctatccaggcagaattgctgaaagtcaaacaaaagataaaggcacagaaagataaa
gagaaggcagtatatgcaaaaatgtttgcttag

DBGET integrated database retrieval system