KEGG   Homo sapiens (human): 54822Help
Entry
54822             CDS       T01001                                 

Gene name
TRPM7, ALSPDC, CHAK, CHAK1, LTRPC7, LTrpC-7, TRP-PLIK
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 7
  KO
K04982  transient receptor potential cation channel subfamily M member 7 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04621  NOD-like receptor signaling pathway
hsa04978  Mineral absorption
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    54822 (TRPM7)
   04218 Cellular senescence
    54822 (TRPM7)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    54822 (TRPM7)
  09154 Digestive system
   04978 Mineral absorption
    54822 (TRPM7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    54822 (TRPM7)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    54822 (TRPM7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     54822 (TRPM7)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   54822 (TRPM7)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   54822 (TRPM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LSDAT_euk Alpha_kinase TRPM_tetra LSDAT_prok Ion_trans
Motif
Other DBs
NCBI-GeneID: 54822
NCBI-ProteinID: NP_060142
OMIM: 605692
HGNC: 17994
Ensembl: ENSG00000092439
Vega: OTTHUMG00000172449
Pharos: Q96QT4(Tbio)
UniProt: Q96QT4 A0A024R5V1
LinkDB All DBs
Position
15q21.2
AA seq 1865 aa AA seqDB search
MSQKSWIESTLTKRECVYIIPSSKDPHRCLPGCQICQQLVRCFCGRLVKQHACFTASLAM
KYSDVKLGDHFNQAIEEWSVEKHTEQSPTDAYGVINFQGGSHSYRAKYVRLSYDTKPEVI
LQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGV
AKHVGDALKEHASRSSRKICTIGIAPWGVIENRNDLVGRDVVAPYQTLLNPLSKLNVLNN
LHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTV
LEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQNE
ALHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALLKGTNASAFDQLILTLAWDRV
DIAKNHVFVYGQQWLVGSLEQAMLDALVMDRVAFVKLLIENGVSMHKFLTIPRLEELYNT
KQGPTNPMLFHLVRDVKQGNLPPGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSL
GGNNRRSGRNTSSSTPQLRKSHESFGNRADKKEKMRHNHFIKTAQPYRPKIDTVMEEGKK
KRTKDEIVDIDDPETKRFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYR
SMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQSFRQDETMAMKLLTYELKNWSNST
CLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILLLEYKTKA
EMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLP
ITRKFYAFYHAPIVKFWFNTLAYLGFLMLYTFVVLVQMEQLPSVQEWIVIAYIFTYAIEK
VREIFMSEAGKVNQKIKVWFSDYFNISDTIAIISFFIGFGLRFGAKWNFANAYDNHVFVA
GRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKMVANMFYIVVIMALVLLSFGVPRKA
ILYPHEAPSWTLAKDIVFHPYWMIFGEVYAYEIDVCANDSVIPQICGPGTWLTPFLQAVY
LFVQYIIMVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIMAYHEKPVLPPPLIILSHIVS
LFCCICKRRKKDKTSDGPKLFLTEEDQKKLHDFEEQCVEMYFNEKDDKFHSGSEERIRVT
FERVEQMCIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTLTAQKASEASKV
HNEITRELSISKHLAQNLIDDGPVRPSVWKKHGVVNTLSSSLPQGDLESNNPFHCNILMK
DDKDPQCNIFGQDLPAVPQRKEFNFPEAGSSSGALFPSAVSPPELRQRLHGVELLKIFNK
NQKLGSSSTSIPHLSSPPTKFFVSTPSQPSCKSHLETGTKDQETVCSKATEGDNTEFGAF
VGHRDSMDLQRFKETSNKIKILSNNNTSENTLKRVSSLAGFTDCHRTSIPVHSKQAEKIS
RRPSTEDTHEVDSKAALIPDWLQDRPSNREMPSEEGTLNGLTSPFKPAMDTNYYYSAVER
NNLMRLSQSIPFTPVPPRGEPVTVYRLEESSPNILNNSMSSWSQLGLCAKIEFLSKEEMG
GGLRRAVKVQCTWSEHDILKSGHLYIIKSFLPEVVNTWSSIYKEDTVLHLCLREIQQQRA
AQKLTFAFNQMKPKSIPYSPRFLEVFLLYCHSAGQWFAVEECMTGEFRKYNNNNGDEIIP
TNTLEEIMLAFSHWTYEYTRGELLVLDLQGVGENLTDPSVIKAEEKRSCDMVFGPANLGE
DAIKNFRAKHHCNSCCRKLKLPDLKRNDYTPDKIIFPQDEPSDLNLQPGNSTKESESTNS
VRLML
NT seq 5598 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaaatcctggatagaaagcactttgaccaagagggaatgtgtatatattata
ccaagttccaaggaccctcacagatgccttccaggatgtcaaatttgtcagcaactcgtc
aggtgtttttgtggtcgcttggtcaagcaacatgcttgttttactgcaagtcttgccatg
aaatactcagatgtgaaattgggtgaccattttaatcaggcaatagaagaatggtctgtg
gaaaagcatacagaacagagcccaacggatgcttatggagtcataaattttcaagggggt
tctcattcctacagagctaagtatgtgaggctatcatatgacaccaaacctgaagtcatt
ctgcaacttctgcttaaagaatggcaaatggagttacccaaacttgttatctctgtacat
gggggcatgcagaaatttgagcttcacccacgaatcaagcagttgcttggaaaaggtctt
attaaagctgcagttacaactggagcctggattttaactggaggagtaaacacaggtgtg
gcaaaacatgttggagatgccctcaaagaacatgcttccagatcatctcgaaagatttgc
actatcggaatagctccatggggagtgattgaaaacagaaatgatcttgttgggagagat
gtggttgctccttatcaaaccttattgaaccccctgagcaaattgaatgttttgaataat
ctgcattcccatttcatattggtggatgatggcactgttggaaagtatggggcggaagtc
agactgagaagagaacttgaaaaaactattaatcagcaaagaattcatgctaggattggc
cagggtgtccctgtggtggcacttatatttgagggtgggccaaatgttatcctcacagtt
cttgaataccttcaggaaagcccccctgttccagtagttgtgtgtgaaggaacaggcaga
gctgcagatctgctagcgtatattcataaacaaacagaagaaggagggaatcttcctgat
gcagcagagcccgatattatttccactatcaaaaaaacatttaactttggccagaatgaa
gcacttcatttatttcaaacactgatggagtgcatgaaaagaaaggagcttatcactgtt
ttccatattgggtcagatgaacatcaagatatagatgtagcaatacttactgcactgcta
aaaggtactaatgcatctgcatttgaccagcttatccttacattggcatgggatagagtt
gacattgccaaaaatcatgtatttgtttatggacagcagtggctggttggatccttggaa
caagctatgcttgatgctcttgtaatggatagagttgcatttgtaaaacttcttattgaa
aatggagtaagcatgcataaattccttaccattccgagactggaagaactttacaacact
aaacaaggtccaactaatccaatgctgtttcatcttgttcgagacgtcaaacagggaaat
cttcctccaggatataagatcactctgattgatataggacttgttattgaatatctcatg
ggaggaacctacagatgcacctatactaggaaacgttttcgattaatatataatagtctt
ggtggaaataatcggaggtctggccgaaatacctccagcagcactcctcagttgcgaaag
agtcatgaatcttttggcaatagggcagataaaaaggaaaaaatgaggcataaccatttc
attaagacagcacagccctaccgaccaaagattgatacagttatggaagaaggaaagaag
aaaagaaccaaagatgaaattgtagacattgatgatccagaaaccaagcgctttccttat
ccacttaatgaacttttaatttgggcttgccttatgaagaggcaggtcatggcccgtttt
ttatggcaacatggtgaagaatcaatggctaaagcattagttgcctgtaagatctatcgt
tcaatggcatatgaagcaaagcagagtgacctggtagatgatacttcagaagaactaaaa
cagtattccaatgattttggtcagttggccgttgaattattagaacagtccttcagacaa
gatgaaaccatggctatgaaattgctcacttatgaactgaagaactggagtaattcaacc
tgccttaagttagcagtttcttcaagacttagaccttttgtagctcacacctgtacacaa
atgttgttatctgatatgtggatgggaaggctgaatatgaggaaaaattcctggtacaag
gtcatactaagcattttagttccacctgccatattgctgttagagtataaaactaaggct
gaaatgtcccatatcccacaatctcaagatgctcatcagatgacaatggatgacagcgaa
aacaactttcagaacataacagaagagatccccatggaagtgtttaaagaagtacggatt
ttggatagtaatgaaggaaagaatgagatggagatacaaatgaaatcaaaaaagcttcca
attacgcgaaagttttatgccttttatcatgcaccaattgtaaaattctggtttaacacg
ttggcatatttaggatttctgatgctttatacatttgtggttcttgtacaaatggaacag
ttaccttcagttcaagaatggattgttattgcttatatttttacttatgccattgagaaa
gtccgtgagatctttatgtctgaagctgggaaagtaaaccagaagattaaagtatggttt
agtgattacttcaacatcagtgatacaattgccataatttctttcttcattggatttgga
ctaagatttggagcaaaatggaactttgcaaatgcatatgataatcatgtttttgtggct
ggaagattaatttactgtcttaacataatattttggtatgtgcgtttgctagattttcta
gctgtaaatcaacaggcaggaccttatgtaatgatgattggaaaaatggtggccaatatg
ttctacattgtagtgattatggctcttgtattacttagttttggtgttcccagaaaggca
atactttatcctcatgaagcaccatcttggactcttgctaaagatatagtttttcaccca
tactggatgatttttggtgaagtttatgcatacgaaattgatgtgtgtgcaaatgattct
gttatccctcaaatctgtggtcctgggacgtggttgactccatttcttcaagcagtctac
ctctttgtacagtatatcattatggttaatcttcttattgcatttttcaacaatgtgtat
ttacaagtgaaggcaatttccaatattgtatggaagtaccagcgttatcattttattatg
gcttatcatgagaaaccagttctgcctcctccacttatcattcttagccatatagtttct
ctgttttgctgcatatgtaagagaagaaagaaagataagacttccgatggaccaaaactt
ttcttaacagaagaagatcaaaagaaacttcatgattttgaagagcagtgtgttgaaatg
tatttcaatgaaaaagatgacaaatttcattctgggagtgaagagagaattcgtgtcact
tttgaaagagtggaacagatgtgcattcagattaaagaagttggagatcgtgtcaactac
ataaaaagatcattacaatcattagattctcaaattggccatttgcaagatctttcagcc
ctgacggtagatacattaaaaacactcactgcccagaaagcgtcggaagctagcaaagtt
cataatgaaatcacacgagaactgagcatttccaaacacttggctcaaaaccttattgat
gatggtcctgtaagaccttctgtatggaaaaagcatggtgttgtaaatacacttagctcc
tctcttcctcaaggtgatcttgaaagtaataatccttttcattgtaatattttaatgaaa
gatgacaaagatccccagtgtaatatatttggtcaagacttacctgcagtaccccagaga
aaagaatttaattttccagaggctggttcctcttctggtgccttattcccaagtgctgtt
tcccctccagaactgcgacagagactacatggggtagaactcttaaaaatatttaataaa
aatcaaaaattaggcagttcatctactagcataccacatctgtcatccccaccaaccaaa
ttttttgttagtacaccatctcagccaagttgcaaaagccacttggaaactggaaccaaa
gatcaagaaactgtttgctctaaagctacagaaggagataatacagaatttggagcattt
gtaggacacagagatagcatggatttacagaggtttaaagaaacatcaaacaagataaaa
atactatccaataacaatacttctgaaaacactttgaaacgagtgagttctcttgctgga
tttactgactgtcacagaacttccattcctgttcattcaaaacaagcagaaaaaatcagt
agaaggccatctaccgaagacactcatgaagtagattccaaagcagctttaataccggat
tggttacaagatagaccatcaaacagagaaatgccatctgaagaaggaacattaaatggt
ctcacttctccatttaagccagctatggatacaaattactattattcagctgtggaaaga
aataacttgatgaggttatcacagagcattccatttacacctgtgcctccaagaggggag
cctgtcacagtgtatcgtttggaagagagttcacccaacatactaaataacagcatgtct
tcttggtcacaactaggcctctgtgccaaaatagagtttttaagcaaagaggagatggga
ggaggtttacgaagagctgtcaaagtacagtgtacctggtcagaacatgatatcctcaaa
tcagggcatctttatattatcaaatcttttcttccagaggtggttaatacatggtcaagt
atttacaaagaagatacagttctgcatctctgtctgagagaaattcaacaacagagagca
gcacaaaagcttacgtttgcctttaatcaaatgaaacccaaatccataccatattctcca
aggttccttgaagttttcctgctgtattgccattcagcaggacagtggtttgctgtggaa
gaatgtatgactggagaatttagaaaatacaacaataataatggagatgagattattcca
actaatactctggaagagatcatgctagcctttagccactggacttacgaatatacaaga
ggggagttactggtacttgatttgcaaggtgttggtgaaaatttgactgacccatctgtg
ataaaagcagaagaaaagagatcctgtgatatggtttttggcccagcaaatctaggagaa
gatgcaattaaaaacttcagagcaaaacatcactgtaattcttgctgtagaaagcttaaa
cttccagatctgaagaggaatgattatacgcctgataaaattatatttcctcaggatgag
ccttcagatttgaatcttcagcctggaaattccaccaaagaatcagaatcaactaattct
gttcgtctgatgttataa

DBGET integrated database retrieval system