KEGG   Homo sapiens (human): 54831
Entry
54831             CDS       T01001                                 

Gene name
BEST2, VMD2L1
Definition
(RefSeq) bestrophin 2
  KO
K13879  bestrophin-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    54831 (BEST2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    54831 (BEST2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   54831 (BEST2)
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 54831
NCBI-ProteinID: NP_060152
OMIM: 607335
HGNC: 17107
Ensembl: ENSG00000039987
Vega: OTTHUMG00000169293
Pharos: Q8NFU1(Tbio)
UniProt: Q8NFU1
LinkDB
Position
19p13.13
AA seq 509 aa
MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKR
YFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDR
GRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNK
YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVV
TIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGE
DDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEARAPYTAATVFQLRQPSF
QGSTFDITLAKEDMQFQRLDGLDGPMGEAPGDFLQRLLPAGAGMVAGGPLGRRLSFLLRK
NSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEP
FSIVTMPGPRGPAPPWLPSPIGEEEENLA
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgaccgtcacctacacagcccgagtggcgaacgcccgcttcggtggcttctcccagctg
ctgctactgtggcgtgggagcatctacaaactcctgtggcgagagctgctctgcttcctt
gggttctacatggcgctgagtgctgcctaccgctttgtgctgaccgaagggcagaagcgc
tacttcgagaagcttgtgatttattgtgaccagtatgccagcctcatccctgtctccttc
gtgcttggcttttatgtgacgctggtggtgaaccgctggtggagccagtacctatgcatg
ccgctgcccgacgcgctcatgtgcgtggtggcgggcaccgtgcacggacgcgacgaccgc
ggccgcctctaccggcgcacactcatgcgctacgcagggctctcggccgtgctcatcctg
cgctccgtcagcaccgcggtgttcaagcgcttccccaccatagaccacgtggtggaggct
gggtttatgacccgcgaggagcgcaagaagtttgaaaacctgaactcatcctacaacaag
tactgggtgccctgcgtctggttctccaacctggcggcacaggcccgacgcgagggccgc
atccgcgacaacagcgcccttaagctgctgctcgaggagctgaatgtttttcggggcaaa
tgtggaatgctctttcactatgactggattagcgtacccctcgtgtacacgcaggtggtg
accatcgcactgtacagctacttcctggcttgcctcattggtcgccagttcctggacccg
gctcagggttacaaagaccacgacctagacctgtgtgtgcccatcttcaccctcttgcag
ttcttcttctacgccggctggctcaaggtagctgagcagctcatcaaccccttcggagag
gacgatgatgactttgagaccaactttctgatcgatagaaacttccaggtgtccatgctg
gcagtggacgagatgtatgatgacctggctgtgctggagaaggacttgtactgggatgca
gccgaggctcgcgccccatacacagcggctactgtcttccagctgcggcagccttccttc
cagggctccacctttgacatcacgctggccaaagaagacatgcagttccagcggctggac
ggcttggatggaccgatgggagaggcgcccggcgacttcctgcagcgcctcctgccggcg
ggcgcgggcatggtcgcgggaggcccgctgggccggcgcctgtcctttctactccgcaag
aacagctgcgtgtcggaggcgtctactggggccagctgctcatgcgcggttgtccccgaa
ggcgcggccccggagtgcagctgcggggacccgctgctcgaccccggcctgccggagccc
gaggccccgccccctgcgggtcccgaaccgcttaccctcatccctgggcctgtcgagccc
ttcagcatcgtgaccatgcccgggccccggggtccggcgccaccctggctgcccagccct
attggcgaggaggaggagaatctggcctga

DBGET integrated database retrieval system