KEGG   Homo sapiens (human): 54894Help
Entry
54894             CDS       T01001                                 

Gene name
RNF43, RNF124, SSPCS, URCC
Definition
(RefSeq) ring finger protein 43
  KO
K15694  RING finger protein 43 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    54894 (RNF43)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    54894 (RNF43)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     54894 (RNF43)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    54894 (RNF43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ZNRF_3_ecto zf-RING_2 zf-C3HC4_2 zf-RING_11 zf-C3HC4 zf-rbx1 zf-RING_UBOX zf-RING_5 Prok-RING_4 zf-C3HC4_3 zf-ANAPC11 FANCL_C PA
Motif
Other DBs
NCBI-GeneID: 54894
NCBI-ProteinID: NP_001292473
OMIM: 612482
HGNC: 18505
Ensembl: ENSG00000108375 ENSG00000285897
Vega: OTTHUMG00000179077
Pharos: Q68DV7(Tbio)
UniProt: Q68DV7
LinkDB All DBs
Structure
PDB: 

Position
17q22
AA seq 783 aa AA seqDB search
MSGGHQLQLAALWPWLLMATLQAGFGRTGLVLAAAVESERSAEQKAIIRVIPLKMDPTGK
LNLTLEGVFAGVAEITPAEGKLMQSHPLYLCNASDDDNLEPGFISIVKLESPRRAPRPCL
SLASKARMAGERGASAVLFDITEDRAAAEQLQQPLGLTWPVVLIWGNDAEKLMEFVYKNQ
KAHVRIELKEPPAWPDYDVWILMTVVGTIFVIILASVLRIRCRPRHSRPDPLQQRTAWAI
SQLATRRYQASCRQARGEWPDSGSSCSSAPVCAICLEEFSEGQELRVISCLHEFHRNCVD
PWLHQHRTCPLCMFNITEGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAHYHLPAAYLLG
PSRSAVARPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQQRLAGAQHPYAQGWGLSH
LQSTSQHPAACPVPLRRARPPDSSGSGESYCTERSGYLADGPASDSSSGPCHGSSSDSVV
NCTDISLQGVHGSSSTFCSSLSSDFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTG
ETQVSSHVHYHRHRHHHYKKRFQWHGRKPGPETGVPQSRPPIPRTQPQPEPPSPDQQVTR
SNSAAPSGRLSNPQCPRALPEPAPGPVDASSICPSTSSLFNLQKSSLSARHPQRKRRGGP
SEPTPGSRPQDATVHPACQIFPHYTPSVAYPWSPEAHPLICGPPGLDKRLLPETPGPCYS
NSQPVWLCLTPRQPLEPHPPGEGPSEWSSDTAEGRPCPYPHCQVLSAQPGSEEELEELCE
QAV
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtggccaccagctgcagctggctgccctctggccctggctgctgatggctacc
ctgcaggcaggctttggacgcacaggactggtactggcagcagcggtggagtctgaaaga
tcagcagaacagaaagctattatcagagtgatccccttgaaaatggaccccacaggaaaa
ctgaatctcactttggaaggtgtgtttgctggtgttgctgaaataactccagcagaagga
aaattaatgcagtcccacccgctgtacctgtgcaatgccagtgatgacgacaatctggag
cctggattcatcagcatcgtcaagctggagagtcctcgacgggccccccgcccctgcctg
tcactggctagcaaggctcggatggcgggtgagcgaggagccagtgctgtcctctttgac
atcactgaggatcgagctgctgctgagcagctgcagcagccgctggggctgacctggcca
gtggtgttgatctggggtaatgacgctgagaagctgatggagtttgtgtacaagaaccaa
aaggcccatgtgaggattgagctgaaggagcccccggcctggccagattatgatgtgtgg
atcctaatgacagtggtgggcaccatctttgtgatcatcctggcttcggtgctgcgcatc
cggtgccgcccccgccacagcaggccggatccgcttcagcagagaacagcctgggccatc
agccagctggccaccaggaggtaccaggccagctgcaggcaggcccggggtgagtggcca
gactcagggagcagctgcagctcagcccctgtgtgtgccatctgtctggaggagttctct
gaggggcaggagctacgggtcatttcctgcctccatgagttccatcgtaactgtgtggac
ccctggttacatcagcatcggacttgccccctctgcatgttcaacatcacagagggagat
tcattttcccagtccctgggaccctctcgatcttaccaagaaccaggtcgaagactccac
ctcattcgccagcatcccggccatgcccactaccacctccctgctgcctacctgttgggc
ccttcccggagtgcagtggctcggcccccacgacctggtcccttcctgccatcccaggag
ccaggcatgggccctcggcatcaccgcttccccagagctgcacatccccgggctccagga
gagcagcagcgcctggcaggagcccagcacccctatgcacaaggctggggactgagccac
ctccaatccacctcacagcaccctgctgcttgcccagtgcccctacgccgggccaggccc
cctgacagcagtggatctggagaaagctattgcacagaacgcagtgggtacctggcagat
gggccagccagtgactccagctcagggccctgtcatggctcttccagtgactctgtggtc
aactgcacggacatcagcctacagggggtccatggcagcagttctactttctgcagctcc
ctaagcagtgactttgaccccctagtgtactgcagccctaaaggggatccccagcgagtg
gacatgcagcctagtgtgacctctcggcctcgttccttggactcggtggtgcccacaggg
gaaacccaggtttccagccatgtccactaccaccgccaccggcaccaccactacaaaaag
cggttccagtggcatggcaggaagcctggcccagaaaccggagtcccccagtccaggcct
cctattcctcggacacagccccagccagagccaccttctcctgatcagcaagtcaccaga
tccaactcagcagccccttcggggcggctctctaacccacagtgccccagggccctccct
gagccagcccctggcccagttgacgcctccagcatctgccccagtaccagcagtctgttc
aacttgcaaaaatccagcctctctgcccgacacccacagaggaaaaggcgggggggtccc
tccgagcccacccctggctctcggccccaggatgcaactgtgcacccagcttgccagatt
tttccccattacacccccagtgtggcatatccttggtccccagaggcacaccccttgatc
tgtggacctccaggcctggacaagaggctgctaccagaaaccccaggcccctgttactca
aattcacagccagtgtggttgtgcctgactcctcgccagcccctggaaccacatccacct
ggggaggggccttctgaatggagttctgacaccgcagagggcaggccatgcccttatccg
cactgccaggtgctgtcggcccagcctggctcagaggaggaactcgaggagctgtgtgaa
caggctgtgtga

DBGET integrated database retrieval system