KEGG   Homo sapiens (human): 54901
Entry
54901             CDS       T01001                                 

Gene name
CDKAL1
Definition
(RefSeq) CDK5 regulatory subunit associated protein 1 like 1
  KO
K15865  threonylcarbamoyladenosine tRNA methylthiotransferase CDKAL1 [EC:2.8.4.5]
Organism
hsa  Homo sapiens (human)
Disease
H00409  Type 2 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    54901 (CDKAL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.5  tRNA (N6-L-threonylcarbamoyladenosine37-C2)-methylthiotransferase
     54901 (CDKAL1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA modification factors
   Methylthiotransferase
    54901 (CDKAL1)
SSDB
Motif
Pfam: UPF0004 Radical_SAM TRAM
Other DBs
NCBI-GeneID: 54901
NCBI-ProteinID: NP_060244
OMIM: 611259
HGNC: 21050
Ensembl: ENSG00000145996
Vega: OTTHUMG00000014340
Pharos: Q5VV42(Tbio)
UniProt: Q5VV42
LinkDB
Position
6p22.3
AA seq 579 aa
MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTI
PGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFR
NSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLG
QKKDNGRRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASYPIDELVD
RAKQSFQEGVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVEVIPEGAMLRLGMTNPPYILE
HLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGITIAT
DIICGFPGETDQDFQETVKLVEEYKFPSLFINQFYPRPGTPAAKMEQVPAQVKKQRTKDL
SRVFHSYSPYDHKIGERQQVLVTEESFDSKFYVAHNQFYEQVLVPKNPAFMGKMVEVDIY
ESGKHFMKGQPVSDAKVYTPSISKPLAKGEVSGLTKDFRNGLGNQLSSGSHTSAASQCDS
ASSRMVLPMPRLHQDCALRMSVGLALLGLLFAFFVKVYN
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgccttctgcatcctgtgatacactactggatgacatcgaagatatcgtgtctcaggaa
gattcaaaaccacaagataggcattttgtaagaaaggatgttgtcccgaaggtacgaagg
cgaaatacccaaaaatatttgcaagaggaagaaaacagtccaccaagtgacagcactatt
ccaggcatacagaaaatttggatacgaacatggggttgttctcataataattcagatgga
gaatatatggctggacagctagctgcttatggctataaaattacagaaaatgcatccgat
gcagatttatggctcctgaacagttgcactgtaaaaaacccagctgaagaccactttaga
aactcaattaaaaaagctcaagaggagaacaagaaaatcgtactggctggatgcgttcct
caagcccagcctcgccaggactaccttaagggactgagtatcattggggttcagcagata
gatcgtgtggtagaagttgtggaggagacaattaaaggtcactctgtgagactgctgggt
cagaaaaaggataatggaaggcggcttgggggagcacgattggatttgccgaagattagg
aagaatccactgatagaaatcatttccatcaataccgggtgtctcaatgcttgtacctac
tgcaaaactaaacacgccagaggaaatttggccagttatccaattgatgaactagtagat
agagccaaacaatcttttcaagagggtgtttgtgagatatggttgaccagtgaagacacg
ggggcttatggcagagatattggcaccaatctccccacactcctgtggaaactggttgaa
gtgattcctgagggagcaatgctgaggcttggcatgacaaatccgccctatattttagag
catctggaggaaatggcaaaaatccttaatcaccccagagtctacgcttttctgcacata
ccagtccagtctgcctccgacagcgtactcatggaaatgaaaagagaatactgtgtggct
gacttcaaaagagtagtggattttctgaaagagaaagttcctggaataactattgctaca
gatattatctgtggttttcctggagaaacagatcaggattttcaagaaacagtgaaactt
gttgaagagtacaaattcccaagcctgtttattaaccaattttacccaagaccaggaact
cctgctgcaaaaatggaacaagttccagcacaagtgaaaaagcaaaggacaaaagatctt
tctcgggtgtttcattcttacagtccatatgatcacaagattggtgaaagacaacaagtg
ttagtaacagaagaatcttttgattccaagttttatgttgcacacaatcaattctatgag
caggttttagtgccaaagaaccctgcgttcatggggaagatggttgaagtggacatctat
gaatcaggcaaacattttatgaaagggcagccagtatctgatgccaaagtgtacacgccc
tccatcagcaaaccgctagcaaagggagaagtctcgggtttgacaaaggacttcagaaat
gggcttgggaaccagctgagttcaggatcccacacctctgctgcatctcagtgtgactca
gcgagttccagaatggtgctgcccatgccaaggctacatcaagactgtgcgctgaggatg
tccgtgggcttggctctgctgggtcttctttttgctttttttgtcaaggtctataattag

DBGET integrated database retrieval system