KEGG   Homo sapiens (human): 55034
Entry
55034             CDS       T01001                                 

Gene name
MOCOS, HMCS, MCS, MOS
Definition
(RefSeq) molybdenum cofactor sulfurase
  KO
K15631  molybdenum cofactor sulfurtransferase [EC:2.8.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00790  Folate biosynthesis
Network
nt06025  Molybdenum cofactor biosynthesis
  Element
N00890  Molybdenum cofactor biosynthesis
N00891  MOCOS deficiency in molybdenum cofactor biosynthesis
Disease
H00192  Xanthinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    55034 (MOCOS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.9  molybdenum cofactor sulfurtransferase
     55034 (MOCOS)
SSDB
Motif
Pfam: MOSC_N Aminotran_5 MOSC
Other DBs
NCBI-GeneID: 55034
NCBI-ProteinID: NP_060417
OMIM: 613274
HGNC: 18234
Ensembl: ENSG00000075643
Vega: OTTHUMG00000132590
Pharos: Q96EN8(Tbio)
UniProt: Q96EN8
LinkDB
Position
18q12.2
AA seq 888 aa
MAGAAAESGRELWTFAGSRDPSAPRLAYGYGPGSLRELRAREFSRLAGTVYLDHAGATLF
SQSQLESFTSDLMENTYGNPHSQNISSKLTHDTVEQVRYRILAHFHTTAEDYTVIFTAGS
TAALKLVAEAFPWVSQGPESSGSRFCYLTDSHTSVVGMRNVTMAINVISTPVRPEDLWSA
EERSASASNPDCQLPHLFCYPAQSNFSGVRYPLSWIEEVKSGRLHPVSTPGKWFVLLDAA
SYVSTSPLDLSAHQADFVPISFYKIFGFPTGLGALLVHNRAAPLLRKTYFGGGTASAYLA
GEDFYIPRQSVAQRFEDGTISFLDVIALKHGFDTLERLTGGMENIKQHTFTLAQYTYVAL
SSLQYPNGAPVVRIYSDSEFSSPEVQGPIINFNVLDDKGNIIGYSQVDKMASLYNIHLRT
GCFCNTGACQRHLGISNEMVRKHFQAGHVCGDNMDLIDGQPTGSVRISFGYMSTLDDVQA
FLRFIIDTRLHSSGDWPVPQAHADTGETGAPSADSQADVIPAVMGRRSLSPQEDALTGSR
VWNNSSTVNAVPVAPPVCDVARTQPTPSEKAAGVLEGALGPHVVTNLYLYPIKSCAAFEV
TRWPVGNQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGMEPIEV
PLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIKQSSNSQRNAKKKHG
KDQLPGTMATLSLVNEAQYLLINTSSILELHRQLNTSDENGKEELFSLKDLSLRFRANII
INGKRAFEEEKWDEISIGSLRFQVLGPCHRCQMICIDQQTGQRNQHVFQKLSESRETKVN
FGMYLMHASLDLSSPCFLSVGSQVLPVLKENVEGHDLPASEKHQDVTS
NT seq 2667 nt   +upstreamnt  +downstreamnt
atggccggcgcggcggcggagtcagggcgggagctgtggaccttcgcgggttcccgggac
ccgagcgcaccgcggctagcctacggctacggcccgggcagcctgcgcgagctgcgggcg
cgcgagttcagccgcctggcaggaactgtctatcttgaccatgcaggtgccaccttgttc
tcccagagccagctcgaaagcttcactagtgatctcatggaaaacacttatggtaatcct
cacagccagaacatcagcagcaagctcacccatgacactgtggagcaggtgcgctacaga
atcctggcgcacttccacaccaccgcagaagactacactgtgatcttcactgccgggagc
acggctgctctcaaactggtggcagaggcctttccatgggtgtcccagggcccagagagc
agtgggagtcgcttctgttacctcaccgacagccacacctccgtagtgggtatgcggaac
gtgaccatggctataaatgtcatatccaccccggtcaggccagaggacctgtggtctgca
gaggaacgtagtgcttcagccagcaacccagactgccagctgccgcatctcttctgctac
ccagctcagagtaacttttctggagtcagataccccctgtcctggatagaagaggtcaag
tctgggcggttgcaccctgtgagcacgcctgggaagtggtttgtgctgctggatgcagcc
tcctacgtgagcacctcgcctttggacctgtcagctcaccaggccgactttgtccccatc
tccttctataagatcttcgggtttcctacaggcctgggcgctctgctggtccataatcgt
gcggctcctctactgaggaagacctactttggaggagggacagcctctgcgtacctagca
ggagaagacttctacatcccgaggcagtcggtagctcagaggtttgaagatggcaccatc
tcattccttgatgttatcgcgctaaaacatggatttgacaccctagagcgcctcacaggt
ggaatggagaatataaagcagcacaccttcaccttggctcagtatacctacgtggccctg
tcctctctccagtaccccaatggagcccctgtggtgcggatttacagcgattctgagttc
agcagccctgaggttcagggcccaatcatcaattttaatgtgctggatgacaaagggaac
atcattggttactcccaggtggacaaaatggccagtctttacaacatccacctgcgaact
ggctgcttctgtaacactggggcctgccagaggcacctgggcataagcaacgagatggtc
aggaagcattttcaggctggtcatgtctgtggggacaatatggacctcatagatgggcag
cccacaggatctgtgaggatttcatttggatacatgtcgacgctggatgatgtccaggcc
tttcttaggttcatcatagacactcgcctgcactcatcaggggactggcctgtccctcag
gcccatgctgacaccggggagactggagccccatcagcagacagccaggctgatgttata
cctgctgtcatgggcagacgtagcctctcgcctcaggaagatgccctcacaggctccagg
gtttggaacaactcgtctactgtgaatgctgtgcctgtggccccacctgtgtgtgatgtc
gccagaacccagccgactccttcagagaaagctgcaggagtcctggagggggcccttggg
ccacatgttgtcactaacctttatctctatccaatcaaatcctgtgctgcatttgaggtg
accaggtggcctgtaggaaaccaagggctgctatatgaccggagctggatggttgtgaat
cacaatggtgtttgcctgagtcagaagcaggaaccccggctctgcctgatccagcccttc
atcgacttgcggcaaaggatcatggtcatcaaagccaaagggatggagcctatagaggtg
cctcttgaggaaaatagtgaacggactcagattcgccaaagcagggtctgtgctgacaga
gtaagtacttatgattgtggagaaaaaatttcaagctggttgtcaacattttttggccgt
ccttgtcatttgatcaaacaaagttcaaactctcaaaggaatgcaaagaagaaacatgga
aaagatcaacttcctggtacaatggccaccctttctctggtgaatgaggcacagtatctg
ctgatcaacacatccagtattttggaacttcaccggcaactaaacaccagtgatgagaat
ggaaaggaggaattattctcactgaaggatctcagcttgcgttttcgtgccaatattatt
atcaatggaaaaagggcttttgaagaagagaaatgggatgagatttcaattggctctttg
cgtttccaggttttggggccttgtcacagatgccagatgatttgcatcgaccagcaaact
gggcaacgaaaccagcatgttttccaaaaactttctgagagtcgtgaaacaaaggtgaac
tttggcatgtacctgatgcatgcatcattggatttatcctccccatgtttcctgtctgta
ggatctcaggtgctccctgtgttgaaagagaatgtggaaggtcatgatttacctgcatct
gagaaacaccaggatgttacctcctaa

DBGET integrated database retrieval system