KEGG   Homo sapiens (human): 55114
Entry
55114             CDS       T01001                                 

Gene name
ARHGAP17, MST066, MST110, MSTP038, MSTP066, MSTP110, NADRIN, PP367, PP4534, RICH-1, RICH1, WBP15
Definition
(RefSeq) Rho GTPase activating protein 17
  KO
K20638  Rho GTPase-activating protein 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    55114 (ARHGAP17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55114 (ARHGAP17)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    55114 (ARHGAP17)
SSDB
Motif
Pfam: BAR RhoGAP BAR_2 FliJ
Other DBs
NCBI-GeneID: 55114
NCBI-ProteinID: NP_001006635
OMIM: 608293
HGNC: 18239
Ensembl: ENSG00000140750
Vega: OTTHUMG00000177372
Pharos: Q68EM7(Tbio)
UniProt: Q68EM7
LinkDB
Position
16p12.1
AA seq 881 aa
MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSICHHSHKRLVACFQGQHGT
DAERRHKKLPLTALAQNMQEASTQLEDSLLGKMLETCGDAENQLALELSQHEVFVEKEIV
DPLYGIAEVEIPNIQKQRKQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEM
DEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKTLPEMRAH
QDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKKLK
AALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDL
WRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWARNEGTLAEMA
AATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLTTPSSNHSFHTGNDSDSGTLERK
RPASMAVMEGDLVKKESFGVKLMDFQAHRRGGTLNRKHISPAFQPPLPPTDGSTVVPAGP
EPPPQSSRAESSSGGGTVPSSAGILEQGPSPGDGSPPKPKDPVSAAVPAPGRNNSQIASG
QNQPQAAAGSHQLSMGQPHNAAGPSPHTLRRAVKKPAPAPPKPGNPPPGHPGGQSSSGTS
QHPPSLSPKPPTRSPSPPTQHTGQPPGQPSAPSQLSAPRRYSSSLSPIQAPNHPPPQPPT
QATPLMHTKPNSQGPPNPMALPSEHGLEQPSHTPPQTPTPPSTPPLGKQNPSLPAPQTLA
GGNPETAQPHAGTLPRPRPVPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDS
NSRVSEPHRSIFPEMHSDSASKDVPGRILLDIDNDTESTAL
NT seq 2646 nt   +upstreamnt  +downstreamnt
atgaagaagcagttcaaccgcatgaagcagctggctaaccagaccgtgggcagagctgag
aaaacagaagtccttagtgaagatctattacagattgagagacgcctggacacggtgcgg
tcaatatgccaccattcccataagcgcttggtggcatgtttccagggccagcatggcacc
gatgccgagaggagacacaaaaaactgcctctgacagctcttgctcaaaatatgcaagaa
gcatcgactcagctggaagactctctcctggggaagatgctggagacgtgtggagatgct
gagaatcagctggctctcgagctctcccagcacgaagtctttgttgagaaggagatcgtg
gaccctctgtacggcatagctgaggtggagattcccaacatccagaagcagaggaagcag
cttgcaagattggtgttagactgggattcagtcagagccaggtggaaccaagctcacaaa
tcctcaggaaccaactttcaggggcttccatcaaaaatagatactctaaaggaagagatg
gatgaagctggaaataaagtagaacagtgcaaggatcaacttgcagcagacatgtacaac
tttatggccaaagaaggggagtatggcaaattctttgttacgttattagaagcccaagca
gattaccatagaaaagcattagcagtcttagaaaagaccctccccgaaatgcgagcccat
caagataagtgggcggaaaaaccagcctttgggactcccctagaagaacacctgaagagg
agcgggcgcgagattgcgctgcccattgaagcctgtgtcatgctgcttctggagacaggc
atgaaggaggagggccttttccgaattggggctggggcctccaagttaaagaagctgaaa
gctgctttggactgttctacttctcacctggatgagttctattcagacccccatgctgta
gcaggtgctttaaaatcctatttacgggaattgcctgaacctttgatgacttttaatctg
tatgaagaatggacacaagttgcaagtgtgcaggatcaagacaaaaaacttcaagacttg
tggagaacatgtcagaagttgccaccacaaaattttgttaactttagatatttgatcaag
ttccttgcaaagcttgctcagaccagcgatgtgaataaaatgactcccagcaacattgcg
attgtgttaggccctaacttgttatgggccagaaatgaaggaacacttgctgaaatggca
gcagccacatccgtccatgtggttgcagtgattgaacccatcattcagcatgccgactgg
ttcttccctgaagaggtggaatttaatgtatcagaagcatttgtacctctcaccaccccg
agttctaatcactcattccacactggaaacgactctgactcggggaccctggagaggaag
cggcctgctagcatggcggtgatggaaggagacttggtgaagaaggaaagctttggtgtg
aagcttatggacttccaggcccaccggcggggtggcactctaaatagaaagcacatatcc
cccgctttccagccgccacttccgcccacagatggcagcaccgtggtgcccgctggccca
gagccccctccccagagctctagggctgaaagcagctctgggggtgggactgtcccctct
tccgcgggcatactggagcaggggccgagcccaggcgacggcagtcctcccaaaccgaag
gaccctgtatctgcagctgtgccagcaccagggagaaacaacagtcagatagcatctggc
caaaatcagccccaggcagctgctggctcccaccagctctccatgggccaacctcacaat
gctgcagggcccagcccgcatacactgcgccgagctgttaaaaaacccgctccagcaccc
ccgaaaccgggcaacccacctcctggccaccccgggggccagagttcttcaggaacatct
cagcatccacccagtctgtcaccaaagccacccacccgaagcccctctcctcccacccag
cacacgggccagcctccaggccagccctccgccccctcccagctctcagcaccccggagg
tactccagcagcttgtctccaatccaagctcccaatcacccaccgccgcagccccctacg
caggccacgccactgatgcacaccaaacccaatagccagggccctcccaaccccatggca
ttgcccagtgagcatggacttgagcagccatctcacacccctccccagactccaacgccc
cccagtactccgcccctaggaaaacagaaccccagtctgccagctcctcagaccctggca
gggggtaaccctgaaactgcacagccacatgctggaaccttaccgagaccgagaccagta
ccaaagccaaggaaccggcccagcgtgcccccacccccccaacctcctggtgtccactca
gctggggacagcagcctcaccaacacagcaccaacagcttccaagatagtaacagactcc
aattccagggtttcagaaccgcatcgcagcatctttcctgaaatgcactcagactcagcc
agcaaagacgtgcctggccgcatcctgctggatatagacaatgataccgagagcactgcc
ctgtga

DBGET integrated database retrieval system