KEGG   Homo sapiens (human): 5515
Entry
5515              CDS       T01001                                 

Gene name
PPP2CA, NEDLBA, PP2Ac, PP2CA, PP2Calpha, RP-C
Definition
(RefSeq) protein phosphatase 2 catalytic subunit alpha
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Drug target
Fostriecin sodium: D04262
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5515 (PPP2CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5515 (PPP2CA)
   04390 Hippo signaling pathway
    5515 (PPP2CA)
   04071 Sphingolipid signaling pathway
    5515 (PPP2CA)
   04151 PI3K-Akt signaling pathway
    5515 (PPP2CA)
   04152 AMPK signaling pathway
    5515 (PPP2CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5515 (PPP2CA)
   04136 Autophagy - other
    5515 (PPP2CA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5515 (PPP2CA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5515 (PPP2CA)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5515 (PPP2CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    5515 (PPP2CA)
   04730 Long-term depression
    5515 (PPP2CA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5515 (PPP2CA)
   05165 Human papillomavirus infection
    5515 (PPP2CA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    5515 (PPP2CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5515 (PPP2CA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5515 (PPP2CA)
   04131 Membrane trafficking [BR:hsa04131]
    5515 (PPP2CA)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5515 (PPP2CA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5515 (PPP2CA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5515 (PPP2CA)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     5515 (PPP2CA)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5515 (PPP2CA)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    5515 (PPP2CA)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5515 (PPP2CA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5515 (PPP2CA)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 5515
NCBI-ProteinID: NP_002706
OMIM: 176915
HGNC: 9299
Ensembl: ENSG00000113575
Vega: OTTHUMG00000129119
Pharos: P67775(Tchem)
UniProt: P67775 B3KUN1
LinkDB
Structure
PDB: 

Position
5q31.1
AA seq 309 aa
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaaggtgttcaccaaggagctggaccagtggatcgagcagctgaacgagtgc
aagcagctgtccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgtgcaagaggttcgatgtccagttactgtctgtggagatgtgcatggg
caatttcatgatctcatggaactgtttagaattggtggcaaatcaccagatacaaattac
ttgtttatgggagattatgttgacagaggatattattcagttgaaacagttacactgctt
gtagctcttaaggttcgttaccgtgaacgcatcaccattcttcgagggaatcatgagagc
agacagatcacacaagtttatggtttctatgatgaatgtttaagaaaatatggaaatgca
aatgtttggaaatattttacagatctttttgactatcttcctctcactgccttggtggat
gggcagatcttctgtctacatggtggtctctcgccatctatagatacactggatcatatc
agagcacttgatcgcctacaagaagttccccatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgaccgtggtggttggggtatatctcctcgaggagctggttacaccttt
gggcaagatatttctgagacatttaatcatgccaatggcctcacgttggtgtctagagct
caccagctagtgatggagggatataactggtgccatgaccggaatgtagtaacgattttc
agtgctccaaactattgttatcgttgtggtaaccaagctgcaatcatggaacttgacgat
actctaaaatactctttcttgcagtttgacccagcacctcgtagaggcgagccacatgtt
actcgtcgtaccccagactacttcctgtaa

KEGG   Homo sapiens (human): 5516
Entry
5516              CDS       T01001                                 

Gene name
PPP2CB, PP2Abeta, PP2CB
Definition
(RefSeq) protein phosphatase 2 catalytic subunit beta
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Drug target
Fostriecin sodium: D04262
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5516 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5516 (PPP2CB)
   04390 Hippo signaling pathway
    5516 (PPP2CB)
   04071 Sphingolipid signaling pathway
    5516 (PPP2CB)
   04151 PI3K-Akt signaling pathway
    5516 (PPP2CB)
   04152 AMPK signaling pathway
    5516 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5516 (PPP2CB)
   04136 Autophagy - other
    5516 (PPP2CB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5516 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5516 (PPP2CB)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5516 (PPP2CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    5516 (PPP2CB)
   04730 Long-term depression
    5516 (PPP2CB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5516 (PPP2CB)
   05165 Human papillomavirus infection
    5516 (PPP2CB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    5516 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5516 (PPP2CB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5516 (PPP2CB)
   04131 Membrane trafficking [BR:hsa04131]
    5516 (PPP2CB)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5516 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5516 (PPP2CB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5516 (PPP2CB)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     5516 (PPP2CB)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5516 (PPP2CB)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    5516 (PPP2CB)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5516 (PPP2CB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5516 (PPP2CB)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N
Other DBs
NCBI-GeneID: 5516
NCBI-ProteinID: NP_001009552
OMIM: 176916
HGNC: 9300
Ensembl: ENSG00000104695
Vega: OTTHUMG00000163949
Pharos: P62714(Tbio)
UniProt: P62714 A0A140VJS0
LinkDB
Position
8p12
AA seq 309 aa
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgacaaggcgttcaccaaggagctggaccagtgggtcgagcagctgaacgagtgt
aagcagctgaacgagaaccaagtgcggacgctgtgcgagaaggcaaaggaaattttaaca
aaagaatcaaatgtgcaagaggttcgttgccctgttactgtctgtggagatgtgcatggt
caatttcatgatcttatggaactctttagaattggtggaaaatcaccggatacaaactac
ttattcatgggtgactatgtagacagaggatattattcagtggagactgtgactcttctt
gtagcattaaaggtgcgttatccagaacgcattacaatattgagaggaaatcacgaaagc
cgacaaattacccaagtatatggcttttatgatgaatgtctgcgaaagtatgggaatgcc
aacgtttggaaatattttacagatctctttgattatcttccacttacagctttagtagat
ggacagatattctgcctccatggtggcctctctccatccatagacacactggatcatata
agagccctggatcgtttacaggaagttccacatgagggcccaatgtgtgatctgttatgg
tcagatccagatgatcgtggtggatggggtatttcaccacgtggtgctggctacacattt
ggacaagacatttctgaaacctttaaccatgccaatggtctcacactggtttctcgtgcc
caccagcttgtaatggagggatacaattggtgtcatgatcggaatgtggttaccattttc
agtgcacccaattactgttatcgttgtgggaaccaggctgctatcatggaattagatgac
actttaaaatattccttccttcaatttgacccagcgcctcgtcgtggtgagcctcatgtt
acacggcgcaccccagactacttcctataa

KEGG   Homo sapiens (human): 5518
Entry
5518              CDS       T01001                                 

Gene name
PPP2R1A, MRD36, PP2A-Aalpha, PP2AA, PP2AAALPHA, PR65A
Definition
(RefSeq) protein phosphatase 2 scaffold subunit Aalpha
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Disease
H00773  Autosomal dominant mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5518 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5518 (PPP2R1A)
   04390 Hippo signaling pathway
    5518 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    5518 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    5518 (PPP2R1A)
   04152 AMPK signaling pathway
    5518 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5518 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5518 (PPP2R1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5518 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    5518 (PPP2R1A)
   04730 Long-term depression
    5518 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5518 (PPP2R1A)
   05165 Human papillomavirus infection
    5518 (PPP2R1A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    5518 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5518 (PPP2R1A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5518 (PPP2R1A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5518 (PPP2R1A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5518 (PPP2R1A)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5518 (PPP2R1A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5518 (PPP2R1A)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Other DBs
NCBI-GeneID: 5518
NCBI-ProteinID: NP_055040
OMIM: 605983
HGNC: 9302
Ensembl: ENSG00000105568
Vega: OTTHUMG00000137367
Pharos: P30153(Tbio)
UniProt: P30153 A8K7B7
LinkDB
Structure
PDB: 

Position
19q13.41
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcggcggccgacggcgacgactcgctgtaccccatcgcggtgctcatagacgaactc
cgcaatgaggacgttcagcttcgcctcaacagcatcaagaagctgtccaccatcgccttg
gcccttggggttgaaaggacccgaagtgagcttctgcctttccttacagataccatctat
gatgaagatgaggtcctcctggccctggcagaacagctgggaaccttcactaccctggtg
ggaggcccagagtacgtgcactgcctgctgccaccgctggagtcgctggccacagtggag
gagacagtggtgcgggacaaggcagtggagtccttacgggccatctcacacgagcactcg
ccctctgacctggaggcgcactttgtgccgctagtgaagcggctggcgggcggcgactgg
ttcacctcccgcacctcggcctgcggcctcttctccgtctgctacccccgagtgtccagt
gctgtgaaggcggaacttcgacagtacttccggaacctgtgctcagatgacacccccatg
gtgcggcgggccgcagcctccaagctgggggagtttgccaaggtgctggagctggacaac
gtcaagagtgagatcatccccatgttctccaacctggcctctgacgagcaggactcggtg
cggctgctggcggtggaggcgtgcgtgaacatcgcccagcttctgccccaggaggatctg
gaggccctggtgatgcccactctgcgccaggccgctgaagacaagtcctggcgcgtccgc
tacatggtggctgacaagttcacagagctccagaaagcagtggggcctgagatcaccaag
acagacctggtccctgccttccagaacctgatgaaagactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagagttctgtgaaaacctctcagctgactgtcgggagaat
gtgatcatgtcccagatcttgccctgcatcaaggagctggtgtccgatgccaaccaacat
gtcaagtctgccctggcctcagtcatcatgggtctctctcccatcttgggcaaagacaac
accatcgagcacctcttgcccctcttcctggctcagctgaaggatgagtgccctgaggta
cggctgaacatcatctctaacctggactgtgtgaacgaggtgattggcatccggcagctg
tcccagtccctgctccctgccattgtggagctggctgaggacgccaagtggcgggtgcgg
ctggccatcattgagtacatgcccctcctggctggacagctgggagtggagttctttgat
gagaaacttaactccttgtgcatggcctggcttgtggatcatgtatatgccatccgcgag
gcagccaccagcaacctgaagaagctagtggaaaagtttgggaaggagtgggcccatgcc
acaatcatccccaaggtcttggccatgtccggagaccccaactacctgcaccgcatgact
acgctcttctgcatcaatgtgctgtctgaggtctgtgggcaggacatcaccaccaagcac
atgctacccacggttctgcgcatggctggggacccggttgccaatgtccgcttcaatgtg
gccaagtctctgcagaagatagggcccatcctggacaacagcaccttgcagagtgaagtc
aagcccatcctagagaagctgacccaggaccaggatgtggacgtcaaatactttgcccag
gaggctctgactgttctgtctctcgcctga

KEGG   Homo sapiens (human): 5519
Entry
5519              CDS       T01001                                 

Gene name
PPP2R1B, PP2A-Abeta, PR65B
Definition
(RefSeq) protein phosphatase 2 scaffold subunit Abeta
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5519 (PPP2R1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5519 (PPP2R1B)
   04390 Hippo signaling pathway
    5519 (PPP2R1B)
   04071 Sphingolipid signaling pathway
    5519 (PPP2R1B)
   04151 PI3K-Akt signaling pathway
    5519 (PPP2R1B)
   04152 AMPK signaling pathway
    5519 (PPP2R1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5519 (PPP2R1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5519 (PPP2R1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5519 (PPP2R1B)
  09156 Nervous system
   04728 Dopaminergic synapse
    5519 (PPP2R1B)
   04730 Long-term depression
    5519 (PPP2R1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5519 (PPP2R1B)
   05165 Human papillomavirus infection
    5519 (PPP2R1B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    5519 (PPP2R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5519 (PPP2R1B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5519 (PPP2R1B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5519 (PPP2R1B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5519 (PPP2R1B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5519 (PPP2R1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5519 (PPP2R1B)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N M11L CLASP_N Cas_Csm6
Other DBs
NCBI-GeneID: 5519
NCBI-ProteinID: NP_002707
OMIM: 603113
HGNC: 9303
Ensembl: ENSG00000137713
Vega: OTTHUMG00000166741
Pharos: P30154(Tbio)
UniProt: P30154
LinkDB
Position
11q23.1
AA seq 601 aa
MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
SELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKA
VESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQ
QFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEAC
VSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQ
NLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMK
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLAL
A
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggcgggcgcatcagagctcgggaccggcccaggagcagcgggtggagatggagatgat
tcgctatacccgatcgcggttttaatcgacgagctccgcaatgaagacgtgcagctccga
ctcaacagtattaagaagttatcaacaattgccctagcacttggagtagaaaggacccga
agtgaattgttgccatttcttacagatacaatttatgatgaagatgaggtactattagct
cttgctgagcagctgggaaatttcactggcctagtgggaggtcctgactttgcccactgt
ctgctgcctcctttggaaaatctggcaactgtggaagagactgttgttcgtgacaaggct
gtggagtccctgagacagatctcccaggagcatactcctgttgctctggaagcttatttt
gtacctctggtgaaacgcttagcaagtggggattggttcacctctcgcacatctgcatgt
ggtttgttcagcgtttgctatcccagggcatcaaatgctgttaaagcagaaatcagacag
caattccgttccttgtgctcagatgacacaccaatggtacgacgtgctgctgcttccaaa
ttgggtgaatttgcaaaagttttggaattagacagtgtgaaaagtgaaattgttccactg
ttcactagtctagcttcagatgaacaggattcagtgcgcctccttgctgtggaagcttgt
gtcagtattgcccagttattgtctcaggatgaccttgagactttggtgatgcctacactt
cgacaagcagcagaagataaatcttggcgcgttcgctatatggtggctgacagattttca
gagctccagaaagccatgggtcctaaaatcaccctaaatgacctcatccccgcctttcag
aacctacttaaagactgtgaagctgaagtccgggcagctgctgcccacaaagtaaaagaa
cttggtgagaacttgcccattgaagatagagagaccataattatgaatcaaattctgcct
tatataaaggaattagtatccgataccaatcaacatgtcaaatcggctctagcttctgta
attatgggattgtctactattttgggcaaagaaaataccattgaacatcttctacctctt
ttcttagctcagttaaaggatgagtgtcctgacgttcgtttgaatatcatctccaatttg
gattgtgtaaatgaagtgattggaatccgtcagctctctcagtctctccttcctgccata
gtggagctggcagaagatgccaaatggagggtccgcctggccatcattgagtatatgccg
ctgctggcaggccagctgggtgtggaattctttgatgaaaagctgaattctttatgtatg
gcttggctcgtggaccatgtatacgccatccgagaagctgccaccaacaacctcatgaaa
ctagttcagaagtttggtacagagtgggcccaaaatactattgttcccaaagtgttagta
atggcaaatgatcctaattacttgcatagaatgaccactttattctgcattaatgcactg
tctgaggcctgtggtcaggaaataactactaagcaaatgctgcccatcgtattaaaaatg
gcaggagaccaagtagcaaatgttcgcttcaatgtggccaaatctctacaaaagattgga
ccaattctagataccaatgctttacagggagaagtgaagccagtactacagaagttaggt
caagatgaagacatggatgtcaaatactttgcacaggaagctataagtgttcttgcattg
gcataa

KEGG   Homo sapiens (human): 5520
Entry
5520              CDS       T01001                                 

Gene name
PPP2R2A, B55A, B55ALPHA, PR52A, PR55A, PR55alpha
Definition
(RefSeq) protein phosphatase 2 regulatory subunit Balpha
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5520 (PPP2R2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    5520 (PPP2R2A)
   04071 Sphingolipid signaling pathway
    5520 (PPP2R2A)
   04151 PI3K-Akt signaling pathway
    5520 (PPP2R2A)
   04152 AMPK signaling pathway
    5520 (PPP2R2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5520 (PPP2R2A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5520 (PPP2R2A)
  09156 Nervous system
   04728 Dopaminergic synapse
    5520 (PPP2R2A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5520 (PPP2R2A)
   05165 Human papillomavirus infection
    5520 (PPP2R2A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    5520 (PPP2R2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5520 (PPP2R2A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5520 (PPP2R2A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5520 (PPP2R2A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5520 (PPP2R2A)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5520 (PPP2R2A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5520 (PPP2R2A)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 5520
NCBI-ProteinID: NP_002708
OMIM: 604941
HGNC: 9304
Ensembl: ENSG00000221914
Vega: OTTHUMG00000163850
Pharos: P63151(Tchem)
UniProt: P63151 A0A140VJT0
LinkDB
Structure
PDB: 
3DW8

Position
8p21.2
AA seq 447 aa
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggagggaatgatattcagtggtgtttttctcaggtgaaaggagca
gtagatgatgatgtagcagaagcagatataatttctacagtagaatttaatcattctgga
gaattactagcaacaggagataaaggtggtagagttgtcatctttcaacaggagcaggag
aacaaaatccagtctcatagcagaggagaatataatgtttacagcaccttccagagccat
gaaccagagtttgactacttgaaaagtttagaaatagaagaaaagatcaacaaaattagg
tggttaccccagaaaaatgctgctcagtttttattgtctaccaatgataaaacaataaaa
ttatggaaaatcagtgaaagggacaaaagaccagaagggtataacttgaaagaggaggat
ggaaggtatagagatcctactacagttactacactacgagtgccagtctttaggcctatg
gatctaatggttgaggccagtccacgaagaatatttgccaatgctcatacatatcacatc
aactcaatttctattaatagtgattatgaaacatatttatctgcagatgatttgcggatt
aatctttggcatctggaaattacagacaggagttttaacattgtggatatcaagcctgcc
aatatggaagagctaacagaggtgattacagcagcagaatttcatccaaacagctgtaac
acatttgtatacagcagcagtaaaggaactattcggctatgtgacatgagggcatctgcc
ctctgtgatagacattctaaattgtttgaagaacctgaagatcccagtaacaggtcattt
ttttccgaaatcatctcctctatttcggatgtaaaattcagccatagtggtcgatatatg
atgactagagactatttgtcagtcaaaatttgggacttaaatatggaaaacaggcctgtg
gaaacataccaggtgcatgaatacctcagaagtaaactctgttcactgtatgaaaatgac
tgcatatttgacaaatttgaatgttgttggaatggatctgacagtgttgtcatgactgga
tcttacaataatttcttcagaatgtttgacagaaacacaaagcgagacataaccctagaa
gcatcgcgggaaaacaataagcctcgcacagttctgaagcctcgcaaagtctgtgcaagt
ggcaagcgaaagaaagatgaaataagtgttgacagcctagacttcaataagaaaatcctt
cacacagcctggcaccccaaggaaaatatcattgccgtagctactacaaacaatctgtat
atatttcaagacaaagtgaattag

KEGG   Homo sapiens (human): 5521
Entry
5521              CDS       T01001                                 

Gene name
PPP2R2B, B55BETA, PP2AB55BETA, PP2ABBETA, PP2APR55B, PP2APR55BETA, PR2AB55BETA, PR2ABBETA, PR2APR55BETA, PR52B, PR55-BETA, PR55BETA, SCA12
Definition
(RefSeq) protein phosphatase 2 regulatory subunit Bbeta
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Disease
H00063  Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5521 (PPP2R2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    5521 (PPP2R2B)
   04071 Sphingolipid signaling pathway
    5521 (PPP2R2B)
   04151 PI3K-Akt signaling pathway
    5521 (PPP2R2B)
   04152 AMPK signaling pathway
    5521 (PPP2R2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5521 (PPP2R2B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5521 (PPP2R2B)
  09156 Nervous system
   04728 Dopaminergic synapse
    5521 (PPP2R2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5521 (PPP2R2B)
   05165 Human papillomavirus infection
    5521 (PPP2R2B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    5521 (PPP2R2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5521 (PPP2R2B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5521 (PPP2R2B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5521 (PPP2R2B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5521 (PPP2R2B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5521 (PPP2R2B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5521 (PPP2R2B)
SSDB
Other DBs
NCBI-GeneID: 5521
NCBI-ProteinID: NP_858061
OMIM: 604325
HGNC: 9305
Ensembl: ENSG00000156475
Vega: OTTHUMG00000163381
Pharos: Q00005(Tbio)
UniProt: Q00005
LinkDB
Position
5q32
AA seq 443 aa
MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQ
VHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKV
SERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSIS
VNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVY
SSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRD
YLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNN
FFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAW
HPSENIIAVAATNNLYIFQDKVN
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggaggaggacattgatacccgcaaaatcaacaacagtttcctgcgcgaccacagctat
gcgaccgaagctgacattatctctacggtagaattcaaccacacgggagaattactagcg
acaggggacaaggggggtcgggttgtaatatttcaacgagagcaggagagtaaaaatcag
gttcatcgtaggggtgaatacaatgtttacagcacattccagagccatgaacccgagttc
gattacctgaagagtttagaaatagaagaaaaaatcaataaaataagatggctcccccag
cagaatgcagcttactttcttctgtctactaatgataaaactgtgaagctgtggaaagtc
agcgagcgtgataagaggccagaaggctacaatctgaaagatgaggagggccggctccgg
gatcctgccaccatcacaaccctgcgggtgcctgtcctgagacccatggacctgatggtg
gaggccaccccacgaagagtatttgccaacgcacacacatatcacatcaactccatatct
gtcaacagcgactatgaaacctacatgtccgctgatgacctgaggattaacctatggaac
tttgaaataaccaatcaaagttttaatattgtggacattaagccagccaacatggaggag
ctcacggaggtgatcacagcagccgagttccacccccatcattgcaacaccttcgtgtac
agcagcagcaaagggacaatccggctgtgtgacatgcgggcatctgccctgtgtgacagg
cacaccaaattttttgaagagccggaagatccaagcaacagatcatttttctctgaaatt
atctcttcgatttcggatgtgaagttcagccacagtgggaggtatatcatgaccagggac
tacttgaccgtcaaagtctgggatctcaacatggaaaaccgccccatcgagacttaccag
gttcatgactacctccgcagcaagctgtgttccctctatgaaaatgactgcatttttgat
aaatttgagtgtgtgtggaatgggtcagacagtgtcatcatgacaggctcctacaacaac
ttcttcaggatgttcgacagaaacaccaagcgtgatgtgacccttgaggcttcgagggaa
aacagcaagccccgggctatcctcaaaccccgaaaagtgtgtgtggggggcaagcggaga
aaagacgagatcagtgtcgacagtctggactttagcaaaaagatcttgcatacagcttgg
catccttcagaaaatattatagcagtggcggctacaaataacctatatatattccaggac
aaggttaactag

KEGG   Homo sapiens (human): 5522
Entry
5522              CDS       T01001                                 

Gene name
PPP2R2C, B55-GAMMA, B55gamma, IMYPNO, IMYPNO1, PR52, PR55G
Definition
(RefSeq) protein phosphatase 2 regulatory subunit Bgamma
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5522 (PPP2R2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    5522 (PPP2R2C)
   04071 Sphingolipid signaling pathway
    5522 (PPP2R2C)
   04151 PI3K-Akt signaling pathway
    5522 (PPP2R2C)
   04152 AMPK signaling pathway
    5522 (PPP2R2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5522 (PPP2R2C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5522 (PPP2R2C)
  09156 Nervous system
   04728 Dopaminergic synapse
    5522 (PPP2R2C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5522 (PPP2R2C)
   05165 Human papillomavirus infection
    5522 (PPP2R2C)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    5522 (PPP2R2C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5522 (PPP2R2C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5522 (PPP2R2C)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5522 (PPP2R2C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5522 (PPP2R2C)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5522 (PPP2R2C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5522 (PPP2R2C)
SSDB
Other DBs
NCBI-GeneID: 5522
NCBI-ProteinID: NP_065149
OMIM: 605997
HGNC: 9306
Ensembl: ENSG00000074211
Vega: OTTHUMG00000090445
Pharos: Q9Y2T4(Tbio)
UniProt: Q9Y2T4
LinkDB
Position
4p16.1
AA seq 447 aa
MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSDMH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggcgaggacacggacacgcggaaaattaaccacagcttcctgcgggaccacagctat
gtgactgaagctgacatcatctctaccgttgagttcaaccacacgggagagctgctggcc
acaggtgacaagggcggccgggtcgtcatcttccagcgggaaccagagagtaaaaatgcg
ccccacagccagggcgaatacgacgtgtacagcactttccagagccacgagccggagttt
gactatctcaagagcctggagatagaggagaagatcaacaagatcaagtggctcccacag
cagaacgccgcccactcactcctgtccaccaacgataaaactatcaaattatggaagatt
accgaacgagataaaaggcccgaaggatacaacctgaaggatgaagaggggaaacttaag
gacctgtccacggtgacgtcactgcaggtgccagtgctgaagcccatggatctgatggtg
gaggtgagccctcggaggatctttgccaatggccacacctaccacatcaactccatctcc
gtcaacagtgactgcgagacctacatgtcggcggatgacctgcgcatcaacctctggcac
ctggccatcaccgacaggagcttcaacatcgtggacatcaagccggccaacatggaggac
cttacggaggtgatcacagcatctgagttccatccgcaccactgcaacctcttcgtctac
agcagcagcaagggctccctgcggctctgcgacatgcgggcagctgccctgtgtgacaag
cattccaagctctttgaagagcctgaggaccccagtaaccgctcattcttctcggaaatc
atctcctccgtgtccgacgtgaagttcagccacagcggccgctacatgctcacccgggac
taccttacagtcaaggtctgggacctgaacatggaggcaagacccatagagacctaccag
gtccatgactaccttcggagcaagctctgttccctgtacgagaacgactgcattttcgac
aagtttgaatgtgcctggaacgggagcgacagcgtcatcatgaccggggcctacaacaac
ttcttccgcatgttcgatcggaacaccaagcgggacgtgaccctggaggcctcgagggaa
agcagcaagccccgggctgtgctcaagccacggcgcgtgtgcgtggggggcaagcgccgg
cgtgatgacatcagtgtggacagcttggacttcaccaagaagatcctgcacacggcctgg
cacccggctgagaacatcattgccatcgccgccaccaacaacctgtacatcttccaggac
aaggtaaactctgacatgcactag

KEGG   Homo sapiens (human): 55844
Entry
55844             CDS       T01001                                 

Gene name
PPP2R2D, B55D, B55delta, MDS026
Definition
(RefSeq) protein phosphatase 2 regulatory subunit Bdelta
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    55844 (PPP2R2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    55844 (PPP2R2D)
   04071 Sphingolipid signaling pathway
    55844 (PPP2R2D)
   04151 PI3K-Akt signaling pathway
    55844 (PPP2R2D)
   04152 AMPK signaling pathway
    55844 (PPP2R2D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    55844 (PPP2R2D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    55844 (PPP2R2D)
  09156 Nervous system
   04728 Dopaminergic synapse
    55844 (PPP2R2D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    55844 (PPP2R2D)
   05165 Human papillomavirus infection
    55844 (PPP2R2D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    55844 (PPP2R2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    55844 (PPP2R2D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    55844 (PPP2R2D)
   03036 Chromosome and associated proteins [BR:hsa03036]
    55844 (PPP2R2D)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     55844 (PPP2R2D)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     55844 (PPP2R2D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     55844 (PPP2R2D)
SSDB
Motif
Pfam: Y_phosphatase2
Other DBs
NCBI-GeneID: 55844
NCBI-ProteinID: NP_060931
OMIM: 613992
HGNC: 23732
Ensembl: ENSG00000175470
Vega: OTTHUMG00000019277
Pharos: Q66LE6(Tdark)
UniProt: Q66LE6
LinkDB
Position
10q26.3
AA seq 453 aa
MAGAGGGGCPAGGNDFQWCFSQVKGAIDEDVAEADIISTVEFNYSGDLLATGDKGGRVVI
FQREQENKSRPHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLST
NDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFAN
AHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEF
HPHQCNVFVYSSSKGTIRLCDMRSSALCDRHSKFFEEPEDPSSRSFFSEIISSISDVKFS
HSGRYMMTRDYLSVKVWDLNMESRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSD
SAIMTGSYNNFFRMFDRDTRRDVTLEASRESSKPRASLKPRKVCTGGKRRKDEISVDSLD
FNKKILHTAWHPVDNVIAVAATNNLYIFQDKIN
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcaggagccggaggcggcggctgccccgcgggcggcaacgacttccagtggtgcttc
tcgcaggtcaagggggccatcgacgaggacgtggccgaagcggacatcatttccaccgtt
gagtttaattactctggagatcttcttgcaacaggagacaagggcggcagagttgttatt
tttcagcgtgaacaagagaataaaagccgccctcattctaggggagaatataatgtttac
agcacctttcaaagtcatgaaccggagtttgactatttgaaaagtctagaaattgaggaa
aaaattaataaaattaggtggttaccacaacagaatgctgctcattttctactgtctaca
aatgataaaactataaaattatggaaaataagtgaacgggataaaagagcagaaggttat
aacctgaaagacgaagatggaagacttcgagacccatttaggatcacggcgctacgggtc
ccaatattgaagcccatggatcttatggtagaagcgagtccacggcgaatttttgcaaat
gctcacacatatcatataaattccatttcagtaaatagtgatcatgaaacatatctttct
gcagatgacctgagaattaatttatggcacttagaaatcacagatagaagctttaacatc
gtggacatcaagcctgctaacatggaggagctgaccgaagtcatcactgcagccgagttc
cacccgcaccagtgcaacgtgttcgtctacagcagtagcaaagggaccatccgcctgtgt
gacatgcgctcctcggccctgtgcgacagacactccaagttttttgaagagcctgaagat
cccagcagtaggtccttcttctcagaaataatttcatccatatccgatgtaaaattcagt
catagtgggcggtacatgatgaccagagactacctgtcggtgaaggtgtgggacctcaac
atggagagcaggccggtggagacccaccaggtccacgagtacctgcgcagcaagctctgc
tctctctatgagaacgactgcatctttgacaagtttgagtgttgctggaacggttcggat
agcgccatcatgaccgggtcctataacaacttcttcaggatgtttgatagagacacgcgg
agggatgtgaccctggaggcctcgagagagagcagcaaaccgcgcgccagcctcaaaccc
cggaaggtgtgtacggggggtaagcggaggaaagacgagatcagtgtggacagtctggac
ttcaacaagaagatcctgcacacagcctggcaccccgtggacaatgtcattgccgtggct
gccaccaataacttgtacatattccaggacaaaatcaactag

DBGET integrated database retrieval system