KEGG   Homo sapiens (human): 552
Entry
552               CDS       T01001                                 

Gene name
AVPR1A, AVPR_V1a, AVPR1, V1aR
Definition
(RefSeq) arginine vasopressin receptor 1A
  KO
K04226  arginine vasopressin receptor 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
Drug target
Balovaptan: D11476
Conivaptan (DG00276): D01236<US> D07748
Felypressin: D04137
Lypressin: D00366
Ornipressin: D07227
Terlipressin (DG00498): D06672 D08571
Vasopressin (Argipressin) (DG00496): D00101<JP/US> D02983 D09820
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    552 (AVPR1A)
   04072 Phospholipase D signaling pathway
    552 (AVPR1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    552 (AVPR1A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    552 (AVPR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    552 (AVPR1A)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Vasopressin
    552 (AVPR1A)
SSDB
Motif
Pfam: 7tm_1 DUF1856 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4
Other DBs
NCBI-GeneID: 552
NCBI-ProteinID: NP_000697
OMIM: 600821
HGNC: 895
Ensembl: ENSG00000166148
Vega: OTTHUMG00000169980
Pharos: P37288(Tclin)
UniProt: P37288 X5D2B0
LinkDB
Structure
PDB: 
1YTV

Position
12q14.2
AA seq 418 aa
MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgcgtctctccgccggtcccgacgcggggccctcgggcaactccagcccatggtggcct
ctggccaccggcgctggcaacacaagccgggaggccgaagccctcggggagggcaacggc
ccaccgagggacgtgcgcaacgaggagctggccaaactggagatcgccgtgctggcggtg
actttcgcggtggccgtgctgggcaacagcagcgtactgctggctctgcaccggacgccg
cgcaagacgtcccgcatgcacctcttcatccgacacctcagcctggccgacctggccgtg
gcattcttccaggtgctgccgcaaatgtgctgggacatcacctaccgcttccgcggcccc
gactggctgtgccgcgtggtgaagcacctgcaggtgttcggcatgtttgcgtcggcctac
atgctggtagtcatgacagccgaccgctacatcgcggtgtgccacccgctcaagactctg
caacagcccgcgcgccgctcgcgcctcatgatcgcggccgcctgggtgctgagcttcgtg
ctgagcacgccgcagtacttcgtcttctccatgatcgaggtgaacaatgtcaccaaggcc
cgcgactgctgggccaccttcatccagccctggggttctcgtgcctacgtgacctggatg
acgggcggcatctttgtggcgcccgtggtcatcttgggtacctgctacggcttcatctgc
tacaacatctggtgcaacgtccgcgggaagacggcgtcgcgccagagcaagggtgcagag
caagcgggtgtggccttccaaaaggggttcctgctcgcaccctgtgtcagcagcgtgaag
tccatttcccgggccaagatccgcacggtgaagatgacttttgtgatcgtgacggcttac
atcgtctgctgggcgcctttcttcatcatccagatgtggtctgtctgggatcccatgtcc
gtctggaccgaatcggaaaaccctaccatcaccatcactgcattactgggttccttgaat
agctgctgtaatccctggatatacatgttttttagtggccatctccttcaagactgtgtt
caaagcttcccatgctgccaaaacatgaaggaaaaattcaacaaagaagatactgacagt
atgagcagaagacagactttttattctaacaatcgaagcccaacaaacagtacgggtatg
tggaaggactcgcctaaatcttccaagtccatcaaattcattcctgtttcaacttga

KEGG   Homo sapiens (human): 553
Entry
553               CDS       T01001                                 

Gene name
AVPR1B, AVPR3, V1bR
Definition
(RefSeq) arginine vasopressin receptor 1B
  KO
K04227  arginine vasopressin receptor 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
Drug target
Lypressin: D00366
Ornipressin: D07227
Terlipressin (DG00498): D06672 D08571
Vasopressin (Argipressin) (DG00496): D00101<JP/US> D02983 D09820
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    553 (AVPR1B)
   04072 Phospholipase D signaling pathway
    553 (AVPR1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    553 (AVPR1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    553 (AVPR1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    553 (AVPR1B)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Vasopressin
    553 (AVPR1B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv DUF1856 7tm_4 7TM_GPCR_Srx Srg
Other DBs
NCBI-GeneID: 553
NCBI-ProteinID: NP_000698
OMIM: 600264
HGNC: 896
Ensembl: ENSG00000198049
Vega: OTTHUMG00000184377
Pharos: P47901(Tclin)
UniProt: P47901
LinkDB
Position
1q32.1
AA seq 424 aa
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLG
QLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQG
SGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVG
GGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQ
PRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE
TIIF
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggattctgggcctctgtgggatgccaaccccacccctcggggcaccctctctgccccc
aatgccacaacaccctggctgggccgggatgaggagctggccaaggtggagatcggagtc
ctggccactgtcctggtgctggcgaccgggggcaacctggctgtgctgctgaccctgggc
cagctgggccgcaagcgctcccgcatgcacctgttcgtgctgcacttagccctgacagac
ctggccgtggcgctcttccaggtgctgccacagctgctgtgggacatcacctaccgcttc
cagggccccgacctcctgtgcagggccgtcaagtacctgcaggtgctcagcatgtttgcc
tccacctacatgctgctggccatgacgctggaccgctacctggctgtctgtcaccccctg
cgcagcctccagcagccaggccagtccacctacctgctcatcgctgctccctggctgctg
gccgccatcttcagcctccctcaagtcttcattttttccctgcgggaggtgatccagggc
tcaggggtgctggactgctgggcagacttcggcttcccttgggggccacgggcctacctc
acctggaccaccctggctatcttcgttctgccggtgaccatgctcacggcctgctacagc
ctcatctgccatgagatctgtaaaaacctaaaagtcaagacacaggcctggcgggtggga
ggagggggctggaggacttgggacaggccctcaccttccaccttagctgccaccactcgg
gggctgccatctcgggtcagcagcatcaacaccatctcacgggccaagatccgaacagtg
aagatgacctttgtcatcgtgctggcctacatcgcttgctgggctcccttcttcagtgtc
cagatgtggtccgtgtgggacaagaatgcccctgatgaagattccaccaatgtggctttc
accatctctatgcttttgggcaacctcaacagctgctgcaacccctggatctacatgggc
ttcaacagccacctgttaccgcggcccctgcgtcaccttgcctgctgtgggggtccccag
cccaggatgcgccggcggctctccgacggcagcctctcgagccgccacaccacgctgctg
acccgctccagctgcccggccaccctcagcctcagcctcagcctaaccctcagtgggagg
cccaggcctgaagagtcaccaagggacttggagctggcagatggggaaggcaccgctgag
accatcatcttttag

KEGG   Homo sapiens (human): 554
Entry
554               CDS       T01001                                 

Gene name
AVPR2, ADHR, DI1, DIR, DIR3, NDI, V2R
Definition
(RefSeq) arginine vasopressin receptor 2
  KO
K04228  arginine vasopressin receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04962  Vasopressin-regulated water reabsorption
Network
nt06326  AVP signaling
  Element
N00915  AVP-V2R-PKA signaling pathway
N00916  Mutation-inactivated AVP to AVP-V2R-PKA signaling pathway
N00917  Mutation-activated AVPR2 to AVP-V2R-PKA signaling pathway
Disease
H00252  Congenital nephrogenic diabetes insipidus
H01294  Nephrogenic syndrome of inappropriate antidiuresis
H01682  Syndrome of inappropriate secretion of antidiuretic hormone
H01683  Disorders of antidiuretic hormone (ADH) secretion
Drug target
Conivaptan (DG00276): D01236<US> D07748
Desmopressin (DG00497): D00291 D02235<JP/US>
Lixivaptan: D04752
Lypressin: D00366
Mozavaptane hydrochloride: D01855<JP>
Ornipressin: D07227
Terlipressin (DG00498): D06672 D08571
Tolvaptan (DG03074): D01213<JP/US> D11659
Vasopressin (Argipressin) (DG00496): D00101<JP/US> D02983 D09820
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    554 (AVPR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    554 (AVPR2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    554 (AVPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    554 (AVPR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Vasopressin
    554 (AVPR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 Git3 PhoLip_ATPase_C
Other DBs
NCBI-GeneID: 554
NCBI-ProteinID: NP_000045
OMIM: 300538
HGNC: 897
Ensembl: ENSG00000126895
Vega: OTTHUMG00000024227
Pharos: P30518(Tclin)
UniProt: P30518
LinkDB
Position
Xq28
AA seq 371 aa
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgctcatggcgtccaccacttccgctgtgcctgggcatccctctctgcccagcctgccc
agcaacagcagccaggagaggccactggacacccgggacccgctgctagcccgggcggag
ctggcgctgctctccatagtctttgtggctgtggccctgagcaatggcctggtgctggcg
gccctagctcggcggggccggcggggccactgggcacccatacacgtcttcattggccac
ttgtgcctggccgacctggccgtggctctgttccaagtgctgccccagctggcctggaag
gccaccgaccgcttccgtgggccagatgccctgtgtcgggccgtgaagtatctgcagatg
gtgggcatgtatgcctcctcctacatgatcctggccatgacgctggaccgccaccgtgcc
atctgccgtcccatgctggcgtaccgccatggaagtggggctcactggaaccggccggtg
ctagtggcttgggccttctcgctccttctcagcctgccccagctcttcatcttcgcccag
cgcaacgtggaaggtggcagcggggtcactgactgctgggcctgctttgcggagccctgg
ggccgtcgcacctatgtcacctggattgccctgatggtgttcgtggcacctaccctgggt
atcgccgcctgccaggtgctcatcttccgggagattcatgccagtctggtgccagggcca
tcagagaggcctggggggcgccgcaggggacgccggacaggcagccccggtgagggagcc
cacgtgtcagcagctgtggccaagactgtgaggatgacgctagtgattgtggtcgtctat
gtgctgtgctgggcacccttcttcctggtgcagctgtgggccgcgtgggacccggaggca
cctctggaaggggcgccctttgtgctactcatgttgctggccagcctcaacagctgcacc
aacccctggatctatgcatctttcagcagcagcgtgtcctcagagctgcgaagcttgctc
tgctgtgcccggggacgcaccccacccagcctgggtccccaagatgagtcctgcaccacc
gccagctcctccctggccaaggacacttcatcgtga

DBGET integrated database retrieval system