KEGG   Homo sapiens (human): 55244Help
Entry
55244             CDS       T01001                                 

Gene name
SLC47A1, MATE1
Definition
(RefSeq) solute carrier family 47 member 1
  KO
K03327  multidrug resistance protein, MATE family
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55244 (SLC47A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   55244 (SLC47A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MatE
Motif
Other DBs
NCBI-GeneID: 55244
NCBI-ProteinID: NP_060712
OMIM: 609832
HGNC: 25588
Ensembl: ENSG00000142494
Vega: OTTHUMG00000059466
Pharos: Q96FL8(Tchem)
UniProt: Q96FL8
LinkDB All DBs
Position
17p11.2
AA seq 570 aa AA seqDB search
MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQLMVFLISFISS
VFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSA
LVLLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLN
QGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKL
HQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYE
LAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDH
VGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVG
LPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHANLKVNNV
PRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRK
QLVLRRGLLLLGVFLILLVGILVRFYVRIQ
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcctgaggagcccgcgccagtgcgcggaggcccggaggccacccttgaggtc
cgtgggtcgcgctgcttgcggctgtccgccttccgagaagagctgcgggcgctcttggtc
ctggctggccccgcgttcttggttcagctgatggtgttcctgatcagcttcataagctcc
gtgttctgtggccacctgggcaagctggagctggatgcagtcacgctggcaatcgcggtt
atcaatgtcactggtgtctcagtgggattcggcttatcttctgcctgtgacaccctcatc
tcccagacgtacgggagccagaacctgaagcacgtgggcgtgatcctgcagcggagtgcg
ctcgtcctgctcctctgctgcttcccctgctgggcgctctttctcaacacccagcacatc
ctgctgctcttcaggcaggacccagatgtgtccaggcttacccagacctatgtcacgatc
ttcattccagctcttcctgcaacctttctttatatgttacaagttaaatatttgctcaac
cagggaattgtactgccccagatcgtaactggagttgcagccaaccttgtcaatgccctc
gccaactatctgtttctccatcaactgcatcttggggtgataggctctgcactggcaaac
ttgatttcccagtacaccctggctctactcctctttctctacatcctcgggaaaaaactg
catcaagctacatggggaggctggtccctcgagtgcctgcaggactgggcctccttcctc
cgcctggccatccccagcatgctcatgctgtgcatggagtggtgggcctatgaggtcggg
agcttcctcagtggcatcctcggcatggtggagctgggcgctcagtccatcgtgtatgaa
ctggccatcattgtgtacatggtccctgcaggcttcagtgtggctgccagtgtccgggta
ggaaacgctctgggtgctggagacatggagcaggcacggaagtcctctaccgtttccctg
ctgattacagtgctctttgctgtagccttcagtgtcctgctgttaagctgtaaggatcac
gtggggtacatttttactaccgaccgagacatcattaatctggtggctcaggtggttcca
atttatgctgtttcccacctctttgaagctcttgcttgcacgagtggtggtgttctgagg
gggagtggaaatcagaaggttggagccattgtgaataccattgggtactatgtggttggc
ctccccatcgggatcgcgctgatgtttgcaaccacacttggagtgatgggtctgtggtca
gggatcatcatctgtacagtctttcaagctgtgtgttttctaggctttattattcagcta
aattggaaaaaagcctgtcagcaggctcaggtacacgccaatttgaaagtaaacaacgtg
cctcggagtgggaattctgctctccctcaggatccgcttcacccagggtgccctgaaaac
cttgaaggaattttaacgaacgatgttggaaagacaggcgagcctcagtcagatcagcag
atgcgccaagaagaacctttgccggaacatccacaggacggcgctaaattgtccaggaaa
cagctggtgctgcggcgagggcttctgctcctgggggtcttcttaatcttgctggtgggg
attttagtgagattctatgtcagaattcagtga

DBGET integrated database retrieval system